DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Tmtc1

DIOPT Version :10

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_995615.2 Gene:Tmtc1 / 33455 FlyBaseID:FBgn0051690 Length:859 Species:Drosophila melanogaster


Alignment Length:326 Identity:68/326 - (20%)
Similarity:121/326 - (37%) Gaps:90/326 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 YFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFSQ-ALGVFREAE--QRS 131
            :|..|::.:::.|...|:...:::.||.|:....|..:|.:|..:|...| |:.|.|...  :.|
  Fly   555 HFNLGVVHQKQLNFSSAIPCFRRAIELRPQLAVAYLNLGTSLISLGDHRQEAISVLRTGARLEGS 619

  Fly   132 SRQDHEIYHYLGELLYRAATTQSQKDVASQQQDEARTYFELAVQSGRKLESYVRLAELYRKDKQY 196
            ..:|            |.|..::                        :...|::|:.|||.|.:.
  Fly   620 GVRD------------RGAHVEA------------------------RYTCYLQLSVLYRSDGRL 648

  Fly   197 QKAIEILE---NCLHLTPENSEVLIEISVLYLKINE--------TQKAH-DRLAEVVSIERKCSP 249
            |.|...|.   ..|.|.|:...     :||:|::.|        .:..| .|||..:..|:..: 
  Fly   649 QDAAAALRESLKALPLLPQKQR-----AVLHLRLGEILAELQDWNEAEHQQRLAMQLQPEQGAA- 707

  Fly   250 KGLLAFGAILQSRN-----DIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFIVAISSLR-K 308
              .:.:|..| :||     :.:....:..|:|..||.....:.:    |.::|:.......|| :
  Fly   708 --YVTYGQTL-ARNGSRLAEAESWFKRALQLAPLEPSSHHHYAD----FLEQQERHHEALGLRLR 765

  Fly   309 SVWLSPLNY-------------NALYNLSLIY---IASEQYASAFHTLAAAI----NLRKDNAEC 353
            :..|:|.:|             |.|....|.|   :..:..|:..|....||    .|||:...|
  Fly   766 AAALAPQDYTLQSCVADALRLLNRLAEAELWYRKAVTLQPMAAHAHANLGAILQMRGLRKEAVAC 830

  Fly   354 Y 354
            |
  Fly   831 Y 831

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR repeat 68..95 CDD:276809 4/24 (17%)
LapB 70..347 CDD:442196 63/317 (20%)
TPR repeat 100..130 CDD:276809 8/32 (25%)
TPR repeat 136..175 CDD:276809 2/38 (5%)
TPR repeat 179..209 CDD:276809 10/32 (31%)
TPR repeat 214..242 CDD:276809 8/36 (22%)
TPR repeat 249..277 CDD:276809 5/32 (16%)
BepA 281..423 CDD:443813 20/95 (21%)
TPR repeat 283..311 CDD:276809 4/28 (14%)
TPR repeat 316..346 CDD:276809 9/49 (18%)
TPR repeat 351..377 CDD:276809 2/4 (50%)
Tmtc1NP_995615.2 ArnT 11..>209 CDD:441412
TMTC_DUF1736 271..340 CDD:462468
PilF 501..585 CDD:442297 7/29 (24%)
TPR repeat 518..546 CDD:276809
TPR repeat 551..581 CDD:276809 4/25 (16%)
LapB 556..838 CDD:442196 68/325 (21%)
TPR repeat 586..611 CDD:276809 7/24 (29%)
TPR repeat 634..660 CDD:276809 9/25 (36%)
TPR repeat 671..699 CDD:276809 8/27 (30%)
TPR repeat 704..735 CDD:276809 4/34 (12%)
TPR repeat 740..768 CDD:276809 5/31 (16%)
TPR repeat 773..803 CDD:276809 5/29 (17%)
TPR repeat 808..836 CDD:276809 8/24 (33%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.