DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and BBS8

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_608524.1 Gene:BBS8 / 33217 FlyBaseID:FBgn0031255 Length:549 Species:Drosophila melanogaster


Alignment Length:376 Identity:69/376 - (18%)
Similarity:139/376 - (36%) Gaps:109/376 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 EALRHLQKSAELNPRNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEIYHYLGELLYRA 149
            :|...|.:::.|||......:.:.:.|:      |.| .:.||:.:.:   |.:...:.|:    
  Fly   229 DATSKLYQASRLNPTIYAERETLVKALF------QFL-YYHEADVQKA---HSLCQAVLEV---- 279

  Fly   150 ATTQSQKDVAS---------QQQ-----------DEARTYFELAVQSGRKLESYVRLAELYRKDK 194
               :.||...|         |||           ..|..:.:.::.|....::|:.|:.:|::.|
  Fly   280 ---ERQKPSGSTGCTLSWWWQQQMGRCLLALHYPRRAEPFLQQSLTSFPHPDTYLLLSRVYQRIK 341

  Fly   195 QYQKAIEILENCLHLTPENSEVLIEISVLYLKINETQKAHDRLAEVVSIERKCSPKGLLAFGAIL 259
            |.::|:.::...:...|.:....:|    ..:|::..:..:...::..:..|..|..:.:..:|.
  Fly   342 QPERALLVIGEVVDSRPFDVTYRLE----QARIHQAMEQQEDALQLYRLAAKLHPINVESLASIA 402

  Fly   260 QS---RNDIDGALSKYSQIANAEPEIAELWNNIGLC------------FFKKQKFIVAISSLRKS 309
            ..   .|:.:.||..|.:|.:...:..||:.||.||            .|::..........:..
  Fly   403 VGYFYDNNPEMALMYYRRILSLGAQSPELYCNIALCCLYGGQIDLVLPCFQRALATATQPGQKSD 467

  Fly   310 VWLSPLNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYMLLGLCLRKLDDMENAFVAL 374
            :|         ||||.:.:.|..:           ||.|   .|   |.|||             
  Fly   468 IW---------YNLSFVAVTSGDF-----------NLAK---RC---LQLCL------------- 493

  Fly   375 ERASSMATGQQGAGRNPLVVLNFALFCYETGRLALSTEQYNRFMSQAQDLL 425
                 .:..|.||..|     |.|:...::|.: |..:.|   ::.|:|::
  Fly   494 -----TSDAQNGAALN-----NLAVLAAQSGDI-LGAKSY---LNAAKDVM 530

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 8/41 (20%)
TPR repeat 68..95 CDD:276809 2/9 (22%)
TPR_12 97..175 CDD:290160 16/97 (16%)
TPR repeat 100..130 CDD:276809 5/29 (17%)
TPR repeat 136..175 CDD:276809 9/58 (16%)
TPR repeat 179..209 CDD:276809 6/29 (21%)
TPR_19 190..254 CDD:291240 9/63 (14%)
TPR repeat 214..242 CDD:276809 2/27 (7%)
TPR repeat 249..277 CDD:276809 7/30 (23%)
TPR_11 283..348 CDD:290150 15/76 (20%)
TPR repeat 283..311 CDD:276809 7/39 (18%)
TPR repeat 316..346 CDD:276809 5/29 (17%)
TPR repeat 351..377 CDD:276809 5/25 (20%)
BBS8NP_608524.1 TPR repeat 299..322 CDD:276809 2/22 (9%)
TPR repeat 327..355 CDD:276809 6/27 (22%)
TPR_16 331..392 CDD:290168 9/64 (14%)
TPR repeat 365..389 CDD:276809 2/27 (7%)
Coatomer_WDAD <378..519 CDD:281977 37/190 (19%)
TPR_11 394..457 CDD:290150 13/62 (21%)
TPR repeat 394..424 CDD:276809 6/29 (21%)
TPR repeat 429..457 CDD:276809 7/27 (26%)
TPR_11 465..526 CDD:290150 23/113 (20%)
TPR repeat 466..493 CDD:276809 12/52 (23%)
TPR repeat 500..526 CDD:276809 8/34 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467058
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.