DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and ifit15

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001288040.1 Gene:ifit15 / 322336 ZFINID:ZDB-GENE-030131-1055 Length:429 Species:Danio rerio


Alignment Length:458 Identity:91/458 - (19%)
Similarity:171/458 - (37%) Gaps:118/458 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DANIDWLLHIYFTRREFTRCRRLIERELNRHL-NPEYLYFVQGLIDREEGNHIEALRHLQK---- 92
            :.:..|.|..|  :.|....:|.::.::.:.: :|.:.|.:.|.|.:..|:..|||..|||    
Zfish    13 ECHFTWDLGQY--QNELQGMKREMDLDVPQKISSPVHYYNLLGFIQKSLGSDREALESLQKAESV 75

  Fly    93 -----SAELNPRNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQDH----------EIYHYL 142
                 :.|...|.:.....:....:.:|...::.|...|.|:  .::.|          |:....
Zfish    76 IQEQGTEETAVRLLVNKANMAWVHFHLGELEKSRGYLEELEE--LQRIHPAPPGCPLHPEVSGEK 138

  Fly   143 GELLYRAATTQSQKDVASQQQDEARTYFELAVQSGRKLESYVRLAELYRKDKQYQKAIEILENCL 207
            |..|.:  ..:|:|.:|..       ||::|::           ||..||:.....||.:.:.||
Zfish   139 GWTLVK--FNKSKKRLAID-------YFKMALE-----------AEPERKEWHKGLAISMSKACL 183

  Fly   208 --HLTPENSEVLIE--------------ISVLYL-------KINETQKAHD---RLAEVVSIERK 246
              ..|||....::|              :..|||       |:|..::..|   |..|:|::   
Zfish   184 WYKCTPEQKAEILEKVKTAAEINPNDLLLQALYLVKLSYVTKVNVEREMRDLLERCLEIVNV--- 245

  Fly   247 CSPKGLLAFGAILQSRNDI--DGALSKYSQIANAEPEIAEL---------WNNIGLCFFKKQKFI 300
               .||   ..||:...||  |.::.:..:.....||..::         |....:....:::.|
Zfish   246 ---PGL---NIILKYLGDISFDESIREGERFQERYPESIKVLKCLADTYKWKVYKMNEDTEERVI 304

  Fly   301 VA---ISSLRKSVWLSPLNYNALYNLSLI-YIA--SEQYASAFHTLAAAINLRKDNAE----CY- 354
            :|   |..|.|....:|.::.|...|:.: |.|  :|:....:..|.....|..|..:    || 
Zfish   305 LARKTIELLEKVCGYNPDSHRAKVALAAMHYYAHNTERADEIYQQLLLEEELSPDKWQYIYYCYA 369

  Fly   355 MLLGLCLRKLDDME---------NAFVALERASSMATGQQGAGRNPLVVLNFALFCYETGRLALS 410
            ..|..|.|..:.::         ...|..|::.::.......|::||        |.|..:|..:
Zfish   370 SYLNQCKRFSESVQFHIKGVKTPGDSVDKEKSLNILKKIVWRGKDPL--------CSEIRQLLKT 426

  Fly   411 TEQ 413
            |::
Zfish   427 TQK 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 15/73 (21%)
TPR repeat 68..95 CDD:276809 10/35 (29%)
TPR_12 97..175 CDD:290160 15/87 (17%)
TPR repeat 100..130 CDD:276809 4/29 (14%)
TPR repeat 136..175 CDD:276809 10/48 (21%)
TPR repeat 179..209 CDD:276809 8/31 (26%)
TPR_19 190..254 CDD:291240 21/89 (24%)
TPR repeat 214..242 CDD:276809 9/51 (18%)
TPR repeat 249..277 CDD:276809 7/29 (24%)
TPR_11 283..348 CDD:290150 14/79 (18%)
TPR repeat 283..311 CDD:276809 6/39 (15%)
TPR repeat 316..346 CDD:276809 6/32 (19%)
TPR repeat 351..377 CDD:276809 7/39 (18%)
ifit15NP_001288040.1 TPR_11 <50..>368 CDD:330823 70/348 (20%)
TPR repeat 323..356 CDD:276809 6/32 (19%)
TPR repeat 361..390 CDD:276809 5/28 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.