DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Tmtc3

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_017450330.2 Gene:Tmtc3 / 314785 RGDID:1306351 Length:1022 Species:Rattus norvegicus


Alignment Length:483 Identity:103/483 - (21%)
Similarity:190/483 - (39%) Gaps:83/483 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NIDWLLHIYFTRREFTRCRRLIERELNRHLNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPR 99
            |.||       ..|:|    |....|..:.|...|:...|.....|.|..:||::..::..:.|.
  Rat   532 NWDW-------ESEYT----LFMSALKVNKNNAKLWNNVGHALENEKNFEKALKYFLQATHVQPD 585

  Fly   100 NIETYKEIGRTLYIMGRFSQALGVFREAEQ-------------RSSRQDHEIYHYLGELLYRAAT 151
            :|..:..:|||...:.|..:|...:..|:.             |.:.....:|..|..|:....:
  Rat   586 DIGAHMNVGRTYKNLNRTKEAEESYMLAKSLMPQIIPGKKYAARIAPNHLNVYINLANLIRANES 650

  Fly   152 TQSQKDVASQQQDEARTYFELAVQSGRKLESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEV 216
            ...:.|...:|....|..|:         ::|:...||..|..:..||.|.....|.|...|:::
  Rat   651 RLEEADQLYRQAISMRPDFK---------QAYISRGELLLKMNKPLKAKEAYLKALELDRNNADL 706

  Fly   217 LIEISVLYLKINETQKA---HDRLAEVVSIERKCSPKGLLAFGA--ILQSRNDI---DGALSKYS 273
            ...::::|:::.|..:|   .:|..|:.|..:      |..|.:  ::|...::   ..|..:..
  Rat   707 WYNLAIVYIELKEPDEALKNFNRALELNSRHK------LALFNSAILMQESGEVKLRPEARKRLL 765

  Fly   274 QIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALYNLSLIYIASEQYASAFH 338
            ...|.||:.|..:.|:|:.....:|...|.:.:::::.|.|...:||:||:|:|..:.:...|..
  Rat   766 NYINEEPQDANGYFNLGMLAMDDKKDSEAETWMKRAIKLQPDFRSALFNLALLYSQTAKELKALP 830

  Fly   339 TLAAAINLRKDNAECYMLLG-LCLRKLDDMENAFVALERASSMATGQQGAGRNPLVVLNF----- 397
            .|...:....|:.:..:|.| :.:.:..|:..|....|:...|..... .|::.|.|:.|     
  Rat   831 ILEELLRYYPDHTKGLILKGDILMNQKKDIAGAKKCFEKILEMDPSNV-QGKHNLCVVYFEEKDL 894

  Fly   398 --ALFC-YETGRLALSTEQYNRFMSQAQDLLLPTEYKFQATKLKSLLRISNQGNGILLDSADMGE 459
              |..| .||..||...|...|.:|..:|            |:.|        :||:    |...
  Rat   895 LKAERCLVETLALAPHEEYIQRHLSIVRD------------KIAS--------SGIV----DQPL 935

  Fly   460 SDLGHNRATELLPDELPLE-VNAVVSQN 486
            |.:.....|| ..||:|.| |..::|::
  Rat   936 SPVDKTSGTE-EKDEVPSEDVKEIISES 962

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 14/63 (22%)
TPR repeat 68..95 CDD:276809 6/26 (23%)
TPR_12 97..175 CDD:290160 16/90 (18%)
TPR repeat 100..130 CDD:276809 7/42 (17%)
TPR repeat 136..175 CDD:276809 7/38 (18%)
TPR repeat 179..209 CDD:276809 8/29 (28%)
TPR_19 190..254 CDD:291240 14/66 (21%)
TPR repeat 214..242 CDD:276809 5/30 (17%)
TPR repeat 249..277 CDD:276809 4/32 (13%)
TPR_11 283..348 CDD:290150 15/64 (23%)
TPR repeat 283..311 CDD:276809 5/27 (19%)
TPR repeat 316..346 CDD:276809 8/29 (28%)
TPR repeat 351..377 CDD:276809 5/26 (19%)
Tmtc3XP_017450330.2 DUF1736 366..438 CDD:400627
PEP_TPR_lipo <542..909 CDD:274350 78/382 (20%)
TPR repeat 553..581 CDD:276809 6/27 (22%)
TPR repeat 586..630 CDD:276809 7/43 (16%)
TPR repeat 637..664 CDD:276809 5/26 (19%)
TPR repeat 669..699 CDD:276809 9/38 (24%)
TPR repeat 704..732 CDD:276809 4/27 (15%)
TPR repeat 775..803 CDD:276809 5/27 (19%)
TPR repeat 808..838 CDD:276809 8/29 (28%)
TPR repeat 843..872 CDD:276809 5/28 (18%)
TPR repeat 878..901 CDD:276809 5/23 (22%)
ParB_N_Srx 901..>943 CDD:421688 14/65 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.