Sequence 1: | NP_610636.1 | Gene: | BBS4 / 36167 | FlyBaseID: | FBgn0033578 | Length: | 486 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007695.1 | Gene: | Ifit3 / 309526 | RGDID: | 1359681 | Length: | 411 | Species: | Rattus norvegicus |
Alignment Length: | 260 | Identity: | 56/260 - (21%) |
---|---|---|---|
Similarity: | 97/260 - (37%) | Gaps: | 45/260 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 65 NPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYK---EIGRTLYIMGRFSQALGVFRE 126
Fly 127 AEQRSSRQDHEIYHYLGELLYRAATTQSQK----------DVASQQQ----------------DE 165
Fly 166 ARTYFELAVQSG-RKLESYVRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVLYLKINE 229
Fly 230 TQKAHDRLAEVVSIERKCSPKGLLA-----FGAILQSRNDIDGALSKYSQIANAEPEIAELWNNI 289
Fly 290 289 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
BBS4 | NP_610636.1 | TPR_12 | 63..127 | CDD:290160 | 16/64 (25%) |
TPR repeat | 68..95 | CDD:276809 | 4/26 (15%) | ||
TPR_12 | 97..175 | CDD:290160 | 22/106 (21%) | ||
TPR repeat | 100..130 | CDD:276809 | 9/32 (28%) | ||
TPR repeat | 136..175 | CDD:276809 | 10/64 (16%) | ||
TPR repeat | 179..209 | CDD:276809 | 9/29 (31%) | ||
TPR_19 | 190..254 | CDD:291240 | 18/63 (29%) | ||
TPR repeat | 214..242 | CDD:276809 | 5/27 (19%) | ||
TPR repeat | 249..277 | CDD:276809 | 7/32 (22%) | ||
TPR_11 | 283..348 | CDD:290150 | 0/7 (0%) | ||
TPR repeat | 283..311 | CDD:276809 | 0/7 (0%) | ||
TPR repeat | 316..346 | CDD:276809 | |||
TPR repeat | 351..377 | CDD:276809 | |||
Ifit3 | NP_001007695.1 | TPR_12 | 51..126 | CDD:290160 | 3/26 (12%) |
TPR repeat | 51..79 | CDD:276809 | |||
TPR repeat | 93..123 | CDD:276809 | 3/23 (13%) | ||
TPR_12 | 94..164 | CDD:290160 | 17/66 (26%) | ||
TPR repeat | 136..164 | CDD:276809 | 8/27 (30%) | ||
TPR repeat | 206..236 | CDD:276809 | 5/29 (17%) | ||
TPR_19 | 217..281 | CDD:291240 | 18/66 (27%) | ||
TPR repeat | 241..269 | CDD:276809 | 8/27 (30%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |