DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Lonrf3

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_006257509.1 Gene:Lonrf3 / 298322 RGDID:1565451 Length:809 Species:Rattus norvegicus


Alignment Length:463 Identity:93/463 - (20%)
Similarity:160/463 - (34%) Gaps:131/463 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 IEALRHLQKSAELNPRNIETY--KEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEIYHYLGELL 146
            ::..:.:..||||...|:|..  :|...::.:....:.:..|..|..|....|:.|....|    
  Rat     4 LQTAQMVSLSAELGSNNLELAEPEEPAASMAVGESAAHSEKVTPEGSQPPGAQEPEQSQPL---- 64

  Fly   147 YRAATTQSQKDVASQQQDEARTYFELAVQSGRKLESYVRLAELYRKDKQYQKAIEILENCLHLTP 211
              ||:|..:..|...|.|...:...|.    ..||.|.:|:|   :.:...:.:|.|..||..:.
  Rat    65 --AASTPPECKVLLTQADALASRGHLR----EALEVYRQLSE---RQQLVAEQLEQLVRCLADSI 120

  Fly   212 ENSEVLIE-----------ISVLYLKINET-------------QKAHDRLAEVVSI--------- 243
            ...|::..           .:....|..|.             :|.|..|::.||:         
  Rat   121 PQDELMAPAPADPSATSSCCAAALKKAGEAAAVAPEVWDGFKCRKCHGFLSDPVSLWCGHTFCKL 185

  Fly   244 --------ERKCSPKG------LLAFG-----------AILQSRNDI--DGALSKYSQIANAEPE 281
                    :|:|:..|      ::|.|           |.||.|.::  .|.|.|..    ..|.
  Rat   186 CLERGRAADRRCALCGVKLSALMVASGRARGPRRSGPQAPLQLRVNVVLSGLLGKLF----PGPA 246

  Fly   282 IAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALY-NLSLIYIASEQYASAFHTLAAAIN 345
            .|....:.|...:::::...|:....::|.|:| |.:.|| |.|.||...|.:..|.|....|..
  Rat   247 RASQLRHEGNRLYRERQVEAALLKYNEAVRLAP-NDHLLYSNRSQIYFTLESHEDALHDAEIACK 310

  Fly   346 LRKDNAECYMLLGLCLRKLDDMENAFVALERASSMATGQQGAGRNPLVVLNFALFCYETGRLALS 410
            ||....:.:                   ..:|.::||    .|:....:..| |:|       :|
  Rat   311 LRPMGFKAH-------------------FRKAQALAT----LGKVKEALREF-LYC-------VS 344

  Fly   411 TEQYN-RFMSQAQDLL-------LPTEYKFQATKLKSLL-----------RISNQGNGILLDSAD 456
            .:..| |..|:||.||       :|.|.:..:..:..||           .::.:|....|....
  Rat   345 LDGKNKRARSEAQRLLFSFFSPSVPGESQEHSPDILKLLAPHPRLKEHVESMATEGTSHNLPKLS 409

  Fly   457 MGESDLGH 464
            ...|:|.|
  Rat   410 QENSELPH 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 8/44 (18%)
TPR repeat 68..95 CDD:276809 1/10 (10%)
TPR_12 97..175 CDD:290160 16/79 (20%)
TPR repeat 100..130 CDD:276809 5/31 (16%)
TPR repeat 136..175 CDD:276809 9/38 (24%)
TPR repeat 179..209 CDD:276809 9/29 (31%)
TPR_19 190..254 CDD:291240 15/110 (14%)
TPR repeat 214..242 CDD:276809 6/51 (12%)
TPR repeat 249..277 CDD:276809 10/46 (22%)
TPR_11 283..348 CDD:290150 18/65 (28%)
TPR repeat 283..311 CDD:276809 3/27 (11%)
TPR repeat 316..346 CDD:276809 11/30 (37%)
TPR repeat 351..377 CDD:276809 0/25 (0%)
Lonrf3XP_006257509.1 RING 163..200 CDD:302633 7/36 (19%)
TPR_11 247..313 CDD:290150 18/66 (27%)
TPR repeat 248..276 CDD:276809 3/27 (11%)
TPR repeat 281..311 CDD:276809 10/29 (34%)
TPR repeat 316..339 CDD:276809 4/45 (9%)
RING 516..555 CDD:238093
LON_substr_bdg 605..806 CDD:280370
LON 616..802 CDD:271862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.