DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Ifit2

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001019924.1 Gene:Ifit2 / 294091 RGDID:1307804 Length:464 Species:Rattus norvegicus


Alignment Length:491 Identity:103/491 - (20%)
Similarity:183/491 - (37%) Gaps:121/491 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 DANIDWLLHIYFTRREF-------TRCRRLIERELNRHLNPEYLYFVQGLIDREEGNHIEALRHL 90
            |.::|......|.:.||       |.|..|...:..|.||...|..:        |...:.:|. 
  Rat    28 DESLDEFEDRVFNKDEFQNSEFKATMCNLLAYVKHCRGLNEAALKCL--------GEAEDFIRQ- 83

  Fly    91 QKSAELNPRNIETYKEIGRTLYIMGRFSQALGVFREAEQ--RSSRQDHEIYHYLGELLYRAATTQ 153
            |...::..:::.|:.......|.||:.|:|.....:.:|  :.....:.|.:.:.:.....|..:
  Rat    84 QHPDQIEIKSLVTWGNYAWVYYHMGQLSKAQEYLDKVKQVCKKFSSPYRIENPVLDCEEGWARLK 148

  Fly   154 SQKDVASQQQDEARTYFELAVQ---------SGRKLESYVRLAELYRKDKQYQKAIEILENCLHL 209
            ..|:    |.:..:..||.|::         ||..:.:| ||.: :.....|   |:.||..:.|
  Rat   149 CTKN----QNERMKVCFEKALEKDPKNPESTSGWAIANY-RLDD-WPASNDY---IDSLEQAISL 204

  Fly   210 TPENSEVLIEISVLYLKINETQKAHDRLAEVVSIERKCSPKG---LLAFGAILQSRNDIDGALSK 271
            :|:|:.|.:   :|.:|:.|..:  :|..|:|....|..|..   :|.........:|.|.|:..
  Rat   205 SPDNTYVKV---LLAMKLEEVHE--NRAKELVEEALKKDPSAIDTMLGAAKFYVKVHDTDRAIQL 264

  Fly   272 YSQIANAEPEIAELWNNIGLCFFKKQKFIV--------------------AISSLRKSVWLSPLN 316
            ..:...:.|..|.:...:|.|:..|...|:                    |::.|||:..:..:.
  Rat   265 LKKALESMPNNAYVHYYLGCCYRSKVLHILNTEETTSNGNREKLEALIQPALNHLRKAEDIKEMI 329

  Fly   317 YNALYNLSLIYIASEQYASAFHTLAAAIN------------LRKDNAECYMLLGLCLRKLDD--- 366
            .|:..:|:.:|:.::||..|.:......|            ||..|.:.|.      ||.:|   
  Rat   330 ENSCSHLAGLYVTTKQYEEADYYFQKEFNKDLRPLPKQLLHLRYGNFQFYE------RKCEDRAI 388

  Fly   367 ---MENAFVALERASSMATGQQGAGRNPLVVLNFALFCYETGRLALSTEQYNRFMSQAQDLLLPT 428
               ||.  |.:.|.|.    .:|..|:.|            .:|||      |.:|:       .
  Rat   389 YHYMEG--VKINRESK----PKGKMRDKL------------RKLAL------RRLSR-------D 422

  Fly   429 EYKFQATKLKSLLRISNQGNGILLDSADMGESDLGH 464
            |...:|.::.:.||...:|.|  .|.|..||.|.|:
  Rat   423 ESDPEALRILAFLREHREGQG--ADKASEGEEDPGN 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 12/63 (19%)
TPR repeat 68..95 CDD:276809 4/26 (15%)
TPR_12 97..175 CDD:290160 14/79 (18%)
TPR repeat 100..130 CDD:276809 7/31 (23%)
TPR repeat 136..175 CDD:276809 7/38 (18%)
TPR repeat 179..209 CDD:276809 7/29 (24%)
TPR_19 190..254 CDD:291240 16/66 (24%)
TPR repeat 214..242 CDD:276809 6/27 (22%)
TPR repeat 249..277 CDD:276809 5/30 (17%)
TPR_11 283..348 CDD:290150 17/96 (18%)
TPR repeat 283..311 CDD:276809 9/47 (19%)
TPR repeat 316..346 CDD:276809 7/41 (17%)
TPR repeat 351..377 CDD:276809 7/31 (23%)
Ifit2NP_001019924.1 TPR_12 51..126 CDD:290160 17/83 (20%)
TPR repeat 96..122 CDD:276809 6/25 (24%)
TPR repeat 127..167 CDD:276809 7/43 (16%)
TPR repeat 242..270 CDD:276809 4/27 (15%)
TPR repeat 275..325 CDD:276809 9/49 (18%)
TPR repeat 330..355 CDD:276809 6/24 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.