DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Tmtc2

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_796342.2 Gene:Tmtc2 / 278279 MGIID:1914057 Length:836 Species:Mus musculus


Alignment Length:271 Identity:59/271 - (21%)
Similarity:109/271 - (40%) Gaps:63/271 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 YFVQGLIDREEGNHIEALRHLQKSAELNPRNIE---TYK--------EIGRTLYIMGRFSQALGV 123
            |...|:|...:|...||.|...|.:|:...|::   .:|        .:|:..:..||:.:||.|
Mouse   564 YLNTGIILMNQGKTEEARRTFLKCSEIPDENLKDPHAHKSSVTSCLYNLGKLYHEQGRYEEALSV 628

  Fly   124 FREAEQRSSRQ--DHEIYHYLGELLYRAA-----------TTQSQKDVASQQQDEARTYFELAVQ 175
            :|||.|:..|.  ...:|:.:||...|.:           :.:|:.|.....    .||.:|...
Mouse   629 YREAIQKMPRHFAPQSLYNMMGEAYMRLSKLPEAEHWYMESLRSKTDHIPAH----LTYGKLLAL 689

  Fly   176 SGRKLES-----------------YVRLAELYRKDKQYQKAIEILENCLHLTPENSEVLIEISVL 223
            :|||.|:                 |:...:...::.:..:|.|:.:....|  :|:|..:..:..
Mouse   690 TGRKSEAEKFFLKAIELDPTKGNCYMHYGQFLLEESRLTEAAEMAKKAAEL--DNTEFDVVFNAA 752

  Fly   224 YL----KINE-TQKAHDRLAEVVSIERKCSPKGLLAFGAILQSRNDIDGALSKYSQIANAEPE-- 281
            ::    .:|| .:|.:|..|.:    |...|..|:..||||.....:..|.:.|.:....:|:  
Mouse   753 HMLRQASLNEAAEKYYDLAARL----RPNYPAALMNLGAILHLNGRLQKAEANYLRALQLKPDDV 813

  Fly   282 -----IAELWN 287
                 :.:|||
Mouse   814 ITQSNLRKLWN 824

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 18/67 (27%)
TPR repeat 68..95 CDD:276809 8/24 (33%)
TPR_12 97..175 CDD:290160 22/101 (22%)
TPR repeat 100..130 CDD:276809 11/40 (28%)
TPR repeat 136..175 CDD:276809 9/49 (18%)
TPR repeat 179..209 CDD:276809 5/46 (11%)
TPR_19 190..254 CDD:291240 13/68 (19%)
TPR repeat 214..242 CDD:276809 6/32 (19%)
TPR repeat 249..277 CDD:276809 8/27 (30%)
TPR_11 283..348 CDD:290150 3/5 (60%)
TPR repeat 283..311 CDD:276809 3/5 (60%)
TPR repeat 316..346 CDD:276809
TPR repeat 351..377 CDD:276809
Tmtc2NP_796342.2 DUF1736 247..321 CDD:285594
TPR 1 460..492
TPR_11 493..554 CDD:290150
TPR 2 493..526
TPR repeat 493..521 CDD:276809
TPR_1 493..>520 CDD:278916
TPR 3 527..560
TPR repeat 527..555 CDD:276809
TPR_12 557..634 CDD:290160 20/69 (29%)
TPR repeat 560..590 CDD:276809 8/25 (32%)
TPR 4 562..594 9/29 (31%)
TPR repeat 595..634 CDD:276809 10/38 (26%)
TPR 5 606..639 10/32 (31%)
TPR_2 609..639 CDD:285020 10/29 (34%)
ANAPC3 618..703 CDD:289650 23/88 (26%)
TPR repeat 642..671 CDD:276809 4/28 (14%)
TPR 6 643..676 5/32 (16%)
TPR 7 677..710 7/36 (19%)
TPR repeat 679..705 CDD:276809 7/29 (24%)
TPR repeat 710..774 CDD:276809 11/65 (17%)
TPR 8 712..744 5/33 (15%)
TPR 9 746..778 6/35 (17%)
TPR_19 755..822 CDD:291240 15/70 (21%)
TPR 10 779..812 9/32 (28%)
TPR_1 779..812 CDD:278916 9/32 (28%)
TPR repeat 779..807 CDD:276809 8/27 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.