| Sequence 1: | NP_610636.1 | Gene: | BBS4 / 36167 | FlyBaseID: | FBgn0033578 | Length: | 486 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_036552.1 | Gene: | IFIT5 / 24138 | HGNCID: | 13328 | Length: | 482 | Species: | Homo sapiens |
| Alignment Length: | 362 | Identity: | 72/362 - (19%) |
|---|---|---|---|
| Similarity: | 128/362 - (35%) | Gaps: | 102/362 - (28%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 32 SDANIDWLLHIYFTRREFTRCRRLIEREL-----NRHLNPEYLYFVQGLIDREEGNHIE--ALRH 89
Fly 90 LQKSAELNPRNI------------------------ETYKEIGRTLYIM----------GRFSQA 120
Fly 121 LGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDVASQQQ-------DE----ARTYFELAV 174
Fly 175 QSGRKLE-SYVRLAELYRKDKQYQKAIEI------LENC-----------------LHLTPENSE 215
Fly 216 VLIEISVLYLKINETQKAHDRLAEV---VSIERKC----SPKGLLAFGAILQSRNDIDGALSKYS 273
Fly 274 QIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSV 310 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| BBS4 | NP_610636.1 | TPR_12 | 63..127 | CDD:290160 | 17/99 (17%) |
| TPR repeat | 68..95 | CDD:276809 | 7/28 (25%) | ||
| TPR_12 | 97..175 | CDD:290160 | 22/122 (18%) | ||
| TPR repeat | 100..130 | CDD:276809 | 7/63 (11%) | ||
| TPR repeat | 136..175 | CDD:276809 | 13/49 (27%) | ||
| TPR repeat | 179..209 | CDD:276809 | 11/53 (21%) | ||
| TPR_19 | 190..254 | CDD:291240 | 18/93 (19%) | ||
| TPR repeat | 214..242 | CDD:276809 | 3/30 (10%) | ||
| TPR repeat | 249..277 | CDD:276809 | 5/27 (19%) | ||
| TPR_11 | 283..348 | CDD:290150 | 7/28 (25%) | ||
| TPR repeat | 283..311 | CDD:276809 | 7/28 (25%) | ||
| TPR repeat | 316..346 | CDD:276809 | |||
| TPR repeat | 351..377 | CDD:276809 | |||
| IFIT5 | NP_036552.1 | TPR_12 | 49..116 | CDD:315987 | |
| TPR 1 | 51..84 | ||||
| TPR repeat | 53..79 | CDD:276809 | |||
| TPR repeat | 84..133 | CDD:276809 | |||
| TPR 2 | 94..127 | ||||
| TPR 3 | 138..173 | 6/33 (18%) | |||
| TPR repeat | 138..168 | CDD:276809 | 5/28 (18%) | ||
| PEP_TPR_lipo | <157..470 | CDD:274350 | 61/316 (19%) | ||
| TPR 4 | 181..214 | 9/32 (28%) | |||
| TPR repeat | 214..244 | CDD:276809 | 2/29 (7%) | ||
| TPR 5 | 249..282 | 4/32 (13%) | |||
| TPR repeat | 249..277 | CDD:276809 | 4/27 (15%) | ||
| Interaction with the 5'-triphosphate group of PPP-RNA | 254..260 | 0/5 (0%) | |||
| TPR repeat | 282..333 | CDD:276809 | 13/52 (25%) | ||
| TPR 6 | 338..371 | 11/32 (34%) | |||
| TPR repeat | 338..366 | CDD:276809 | 8/27 (30%) | ||
| TPR 7 | 376..410 | 5/35 (14%) | |||
| TPR repeat | 376..405 | CDD:276809 | 3/30 (10%) | ||
| TPR 8 | 435..468 | 6/32 (19%) | |||
| TPR repeat | 435..463 | CDD:276809 | 5/27 (19%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||