DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Uty

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_017174175.1 Gene:Uty / 22290 MGIID:894810 Length:1236 Species:Mus musculus


Alignment Length:439 Identity:82/439 - (18%)
Similarity:167/439 - (38%) Gaps:111/439 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 TRCRRLIERELNRHLNPEYLYFVQGLIDREEGNHIEALRHLQKSAELNPRNIETYKEIGRTLYIM 114
            |||:.  ..::...|| :.::|.:.||.:.||. :|:               :.:.::|....::
Mouse    56 TRCKD--GAKMKTLLN-KAIHFYESLIVKAEGK-VES---------------DFFCQLGHFNLLL 101

  Fly   115 GRFSQALGVFR-----EAEQRSSRQDH----EIYHYLGELLYRAATTQSQKDVASQQQDEARTY- 169
            ..:|:||..::     :.:...:.|:|    :|...:.:||.|            :.::.|..| 
Mouse   102 EDYSKALSSYQRYYSLQTDYWKAFQNHFWWWKITREVWKLLLR------------KFRNAAFLYG 154

  Fly   170 ----------FELAVQSGRKL-----------ESYVRLAELYRKDKQYQKAIE----ILENCLHL 209
                      |:.|:::.:::           |.::||..:::.:..|:.:::    .|.:|...
Mouse   155 LGLVYFYYNAFQWAIRAFQEVLYVDPNFCRAKEIHLRLGFMFKMNTDYESSLKHFQLALIDCNVC 219

  Fly   210 TPENSEVLIEISVLYLKINETQK-------AHDRLAEVVSIERKCSPKGLLAFGAILQSRNDIDG 267
            |..:.|:...|:.||    |||:       |:::|.::.|:..:.....|...| .:....|:.|
Mouse   220 TLSSVEIQFHIAHLY----ETQRKYHSAKAAYEQLLQIESLPSQVKATVLQQLG-WMHHNMDLIG 279

  Fly   268 --------ALSKYSQIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALYNLS 324
                    |:....:....:|...:.|..:|.|:....|...|..|.|:|:..|..:.:...::.
Mouse   280 DNTTKERYAIQYLQKSLEEDPNSGQSWYFLGRCYSCIGKVQDAFVSYRQSIDKSEASADTWCSIG 344

  Fly   325 LIYIASEQYASAFHTLAAAINLRKDNAECYMLLGLCLRKLDDMENAFVA-LERASSMATGQQGAG 388
            ::|....|...|......|:.|...:|..:|.||:.....:..::|... |..|.|.:       
Mouse   345 VLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGILYESCNQPQDAIKCYLNAARSKS------- 402

  Fly   389 RNPLVVLNFALFCYETGRLALSTEQYNRFMSQAQDLLLPTEYKFQATKL 437
                        |..|..|....    :|: |||...||.......|||
Mouse   403 ------------CNNTSALTSRI----KFL-QAQLCNLPQSSLQNKTKL 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 12/68 (18%)
TPR repeat 68..95 CDD:276809 6/26 (23%)
TPR_12 97..175 CDD:290160 14/97 (14%)
TPR repeat 100..130 CDD:276809 4/34 (12%)
TPR repeat 136..175 CDD:276809 9/53 (17%)
TPR repeat 179..209 CDD:276809 6/44 (14%)
TPR_19 190..254 CDD:291240 15/74 (20%)
TPR repeat 214..242 CDD:276809 9/34 (26%)
TPR repeat 249..277 CDD:276809 5/35 (14%)
TPR_11 283..348 CDD:290150 14/64 (22%)
TPR repeat 283..311 CDD:276809 8/27 (30%)
TPR repeat 316..346 CDD:276809 4/29 (14%)
TPR repeat 351..377 CDD:276809 6/26 (23%)
UtyXP_017174175.1 TPR repeat 88..116 CDD:276809 4/42 (10%)
TPR repeat 121..178 CDD:276809 10/68 (15%)
TPR 130..397 CDD:223533 51/283 (18%)
TPR repeat 183..213 CDD:276809 4/29 (14%)
TPR repeat 224..252 CDD:276809 9/31 (29%)
TPR repeat 262..297 CDD:276809 5/35 (14%)
TPR repeat 304..331 CDD:276809 8/26 (31%)
TPR repeat 336..366 CDD:276809 4/29 (14%)
TPR repeat 371..399 CDD:276809 6/27 (22%)
JmjC 935..999 CDD:214721
JmjC 969..1077 CDD:334913
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.