DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and DNAAF4

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_570722.2 Gene:DNAAF4 / 161582 HGNCID:21493 Length:420 Species:Homo sapiens


Alignment Length:436 Identity:95/436 - (21%)
Similarity:152/436 - (34%) Gaps:122/436 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PEYLY--FVQGLIDREE-----GNHIEALRHLQKSAELNPRNIETYKEIGRTLYIMGRFS----- 118
            |.:|:  |:...||.|.     ||........:|.|.:    .||....|....:|.|..     
Human    45 PPFLFEAFLYAPIDDESSKAKIGNDTIVFTLYKKEAAM----WETLSVTGVDKEMMQRIREKSIL 105

  Fly   119 QALGVFREAEQRSSRQDHEIYHYLGELLYRAATTQSQKDVASQQQDEARTYFELAVQSGRKLES- 182
            ||....:||.:..:....|...|...::.: ...:.:|.:...:::|       .:::.:.||: 
Human   106 QAQERAKEATEAKAAAKREDQKYALSVMMK-IEEEERKKIEDMKENE-------RIKATKALEAW 162

  Fly   183 --YVRLAE----LYRKDKQYQKAIEILEN--------------CLHLTPE--NSEVLIEISVLYL 225
              |.|.||    :.|::|..||..:|.|.              ..:|.|:  |||     ::...
Human   163 KEYQRKAEEQKKIQREEKLCQKEKQIKEERKKIKYKSLTRNLASRNLAPKGRNSE-----NIFTE 222

  Fly   226 KINETQKAHDRLAEVVSIERKCSPKGLLAFGAILQSRNDIDGALSKYSQIANAE----------- 279
            |:.|......|  .|.||:...:|:   .|...|:.           ||:|..|           
Human   223 KLKEDSIPAPR--SVGSIKINFTPR---VFPTALRE-----------SQVAEEEEWLHKQAEARR 271

  Fly   280 ---PEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALYNLSLIYIASEQYASAFHTLA 341
               .:|||      ||..|:::        :...||.... |.|:       |:|.|.:|.:...
Human   272 AMNTDIAE------LCDLKEEE--------KNPEWLKDKG-NKLF-------ATENYLAAINAYN 314

  Fly   342 AAINLRKDNAECYMLLGLCLRKLDDM----ENAFVALERASSMATGQQGAGRNPLVVLNFALFC- 401
            .||.|.......|:....|..||.::    |::..|||......|....| |....|.....|| 
Human   315 LAIRLNNKMPLLYLNRAACHLKLKNLHKAIEDSSKALELLMPPVTDNANA-RMKAHVRRGTAFCQ 378

  Fly   402 ---YETG----RLALSTEQYNRFMS-QAQDLLLPTEYKFQATKLKS 439
               |..|    ..||..:..|:.:. .|:.:    ....|.|:|||
Human   379 LELYVEGLQDYEAALKIDPSNKIVQIDAEKI----RNVIQGTELKS 420

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 17/72 (24%)
TPR repeat 68..95 CDD:276809 8/33 (24%)
TPR_12 97..175 CDD:290160 13/82 (16%)
TPR repeat 100..130 CDD:276809 9/34 (26%)
TPR repeat 136..175 CDD:276809 4/38 (11%)
TPR repeat 179..209 CDD:276809 12/50 (24%)
TPR_19 190..254 CDD:291240 18/79 (23%)
TPR repeat 214..242 CDD:276809 6/27 (22%)
TPR repeat 249..277 CDD:276809 5/27 (19%)
TPR_11 283..348 CDD:290150 16/64 (25%)
TPR repeat 283..311 CDD:276809 5/27 (19%)
TPR repeat 316..346 CDD:276809 8/29 (28%)
TPR repeat 351..377 CDD:276809 8/29 (28%)
DNAAF4NP_570722.2 Mediates interaction with ESR1 and STUB1. /evidence=ECO:0000269|PubMed:19423554 7..103 15/61 (25%)
p23_DYX1C1_like 10..87 CDD:107226 12/45 (27%)
TPR_11 289..353 CDD:290150 18/71 (25%)
TPR 1 290..323 11/40 (28%)
TPR repeat 290..318 CDD:276809 9/35 (26%)
TPR repeat 323..353 CDD:276809 7/29 (24%)
TPR 2 324..357 8/32 (25%)
TPR repeat 364..394 CDD:276809 8/30 (27%)
TPR 3 366..399 7/32 (22%)
TPR_1 367..399 CDD:278916 7/31 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.