DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and Ifit1bl2

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:NP_001349059.1 Gene:Ifit1bl2 / 112419 MGIID:2148249 Length:466 Species:Mus musculus


Alignment Length:382 Identity:72/382 - (18%)
Similarity:142/382 - (37%) Gaps:109/382 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 HIYFTRREFTRCRRLIEREL-NRHL-------------NPEY-------LYFVQGLIDREEGNHI 84
            ||:.:..|. ||....|.:: ::|:             :|.|       |.:|:.|    :|...
Mouse    18 HIHDSLDEL-RCHFTWELDIKDKHIHDLEIKISETEFRDPIYSIGMHNLLAYVRHL----KGQQD 77

  Fly    85 EALRHLQ------KSAELNPRNIETYKEIGRTLYIMGRFSQALGVFREAEQRSSRQDHEIYHYLG 143
            |||:.|:      :|.:|:.|::.|:.......|..|..::| .|:.:..::..::      :..
Mouse    78 EALQSLKEAEALIQSEQLSKRSLATWGNCAWLHYHRGSLAEA-QVYLDKVEKVCKE------FSS 135

  Fly   144 ELLYRAATTQ-------SQKDVASQQQDEARTYFELAVQSGRKLE--------SYVRLAELYRKD 193
            ...||....:       :.:...||....|...||.|:    |:|        .|..:|  |..|
Mouse   136 PFRYRLECAEMDCEEGWALRKCGSQNYTRAMACFERAL----KVEPENPEYNAGYADVA--YHLD 194

  Fly   194 KQYQKAIEILENCLHLTPENSEVLIEISVLYLKINETQKAHDRLAEVVSIERKCSPKGLLAFGAI 258
            .....:::.|:..:.:.||:..:.:.:::....:.:|.:|...:.|..               ..
Mouse   195 YYDGNSLQPLKKAVSVKPEDPYLKVLLALKLQDLRKTDEAEKHIKEAT---------------LT 244

  Fly   259 LQSRNDIDGALSKY--------------SQIANAEPEIAELWNNIGLC----FFKKQKFI----- 300
            :.|:|:|.|.::|:              .:....:|....|...||||    ||:.:|..     
Mouse   245 ISSQNNIFGYVAKFYRRKGCVEEALGFLKKALETKPSSPYLHFQIGLCHKTQFFQMKKATSRENR 309

  Fly   301 --------VAISSLRKSVWLSPLNYNALYNLSLIYIASEQYASA---FHTLAAAINL 346
                    :||...:|::.|.|....|..:|:.:|..:.|...|   |..:.:..||
Mouse   310 KRADQSCHLAICHFKKTLELKPTYDRAYIDLAEVYAKNHQQKEAEDNFQEVLSMSNL 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160 19/89 (21%)
TPR repeat 68..95 CDD:276809 10/39 (26%)
TPR_12 97..175 CDD:290160 14/84 (17%)
TPR repeat 100..130 CDD:276809 5/29 (17%)
TPR repeat 136..175 CDD:276809 8/45 (18%)
TPR repeat 179..209 CDD:276809 7/37 (19%)
TPR_19 190..254 CDD:291240 8/63 (13%)
TPR repeat 214..242 CDD:276809 3/27 (11%)
TPR repeat 249..277 CDD:276809 5/41 (12%)
TPR_11 283..348 CDD:290150 21/84 (25%)
TPR repeat 283..311 CDD:276809 11/44 (25%)
TPR repeat 316..346 CDD:276809 6/32 (19%)
TPR repeat 351..377 CDD:276809
Ifit1bl2NP_001349059.1 TPR_11 <63..>353 CDD:330823 59/321 (18%)
TPR repeat 63..94 CDD:276809 9/34 (26%)
TPR repeat 99..129 CDD:276809 5/30 (17%)
TPR repeat 144..174 CDD:276809 6/33 (18%)
TPR repeat 179..210 CDD:276809 5/32 (16%)
TPR repeat 215..241 CDD:276809 2/25 (8%)
TPR repeat 282..329 CDD:276809 11/46 (24%)
TPR_11 <324..>458 CDD:330823 11/43 (26%)
TPR repeat 334..362 CDD:276809 6/27 (22%)
TPR repeat 372..401 CDD:276809
TPR repeat 429..457 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1124
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.