DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BBS4 and LOC110438537

DIOPT Version :9

Sequence 1:NP_610636.1 Gene:BBS4 / 36167 FlyBaseID:FBgn0033578 Length:486 Species:Drosophila melanogaster
Sequence 2:XP_021326752.1 Gene:LOC110438537 / 110438537 -ID:- Length:156 Species:Danio rerio


Alignment Length:152 Identity:67/152 - (44%)
Similarity:105/152 - (69%) Gaps:1/152 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   206 CLHLTPENSEVLIEISVLYLKINETQKAHDRLAEVVSIERKCSPKGLLAFGAILQSRNDIDGALS 270
            |:..:|||:|:|..:.:||::..:.|||.:.|...::.:.. :.|.:||.|:::|:..|.|.|::
Zfish     5 CVRFSPENTELLTTLGLLYMQFGKYQKAFEHLGNALTYDPN-NFKAILAAGSMMQTHGDYDVAMN 68

  Fly   271 KYSQIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSPLNYNALYNLSLIYIASEQYAS 335
            ||...|.|.||...||||||:|||.|:|::.|||.|:::.:|||.::..||||.|:::..:|:||
Zfish    69 KYRVAAYAVPESPPLWNNIGMCFFGKKKYVAAISCLKRANYLSPFDWKILYNLGLVHLTMQQFAS 133

  Fly   336 AFHTLAAAINLRKDNAECYMLL 357
            |||.|:||||||...:|.||||
Zfish   134 AFHFLSAAINLRPRMSELYMLL 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BBS4NP_610636.1 TPR_12 63..127 CDD:290160
TPR repeat 68..95 CDD:276809
TPR_12 97..175 CDD:290160
TPR repeat 100..130 CDD:276809
TPR repeat 136..175 CDD:276809
TPR repeat 179..209 CDD:276809 1/2 (50%)
TPR_19 190..254 CDD:291240 13/47 (28%)
TPR repeat 214..242 CDD:276809 8/27 (30%)
TPR repeat 249..277 CDD:276809 10/27 (37%)
TPR_11 283..348 CDD:290150 35/64 (55%)
TPR repeat 283..311 CDD:276809 15/27 (56%)
TPR repeat 316..346 CDD:276809 15/29 (52%)
TPR repeat 351..377 CDD:276809 5/7 (71%)
LOC110438537XP_021326752.1 TPR_11 23..>154 CDD:330823 57/131 (44%)
TPR repeat 48..75 CDD:276809 10/26 (38%)
TPR repeat 80..110 CDD:276809 15/29 (52%)
TPR repeat 115..142 CDD:276809 13/26 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D334820at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.