| Sequence 1: | NP_610636.1 | Gene: | BBS4 / 36167 | FlyBaseID: | FBgn0033578 | Length: | 486 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_006800.2 | Gene: | TOMM34 / 10953 | HGNCID: | 15746 | Length: | 309 | Species: | Homo sapiens |
| Alignment Length: | 312 | Identity: | 59/312 - (18%) |
|---|---|---|---|
| Similarity: | 113/312 - (36%) | Gaps: | 70/312 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 98 PRNIETYKEIGRTLYIMGRFSQALGVFREA-----EQRSSRQDHEIYHYLGELLY--RAATTQSQ 155
Fly 156 -------KDVASQQQDEARTYFELAVQS-GRKLESYVRLAELYRKDKQYQKAIEILENCL----- 207
Fly 208 ----------HLTPE-----NSEVLIEIS---------------VLYLKINETQKAHDRLAEVVS 242
Fly 243 IERKCSPKGLLAFGAILQSRNDIDGALSKYSQ---IANAEPEIAELWNNIGLCFFKKQKFIVAIS 304
Fly 305 SLRKSVWLSPLNYNALYNLSLIYIASEQYASAFHTLAAAINLRKDNAECYML 356 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| BBS4 | NP_610636.1 | TPR_12 | 63..127 | CDD:290160 | 5/28 (18%) |
| TPR repeat | 68..95 | CDD:276809 | |||
| TPR_12 | 97..175 | CDD:290160 | 19/90 (21%) | ||
| TPR repeat | 100..130 | CDD:276809 | 5/34 (15%) | ||
| TPR repeat | 136..175 | CDD:276809 | 10/47 (21%) | ||
| TPR repeat | 179..209 | CDD:276809 | 5/44 (11%) | ||
| TPR_19 | 190..254 | CDD:291240 | 15/98 (15%) | ||
| TPR repeat | 214..242 | CDD:276809 | 7/42 (17%) | ||
| TPR repeat | 249..277 | CDD:276809 | 7/30 (23%) | ||
| TPR_11 | 283..348 | CDD:290150 | 12/64 (19%) | ||
| TPR repeat | 283..311 | CDD:276809 | 4/27 (15%) | ||
| TPR repeat | 316..346 | CDD:276809 | 7/29 (24%) | ||
| TPR repeat | 351..377 | CDD:276809 | 1/6 (17%) | ||
| TOMM34 | NP_006800.2 | TPR 1 | 9..42 | 5/32 (16%) | |
| TPR repeat | 9..37 | CDD:276809 | 5/27 (19%) | ||
| PLN03088 | <12..>294 | CDD:330826 | 55/298 (18%) | ||
| TPR repeat | 50..80 | CDD:276809 | 10/40 (25%) | ||
| TPR 2 | 51..84 | 9/37 (24%) | |||
| TPR repeat | 85..113 | CDD:276809 | 4/27 (15%) | ||
| TPR 3 | 86..118 | 5/31 (16%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 161..189 | 4/27 (15%) | |||
| TPR 4 | 193..226 | 8/32 (25%) | |||
| TPR repeat | 193..221 | CDD:276809 | 7/27 (26%) | ||
| TPR repeat | 226..256 | CDD:276809 | 5/32 (16%) | ||
| TPR 5 | 227..260 | 5/32 (16%) | |||
| TPR repeat | 261..289 | CDD:276809 | 6/27 (22%) | ||
| TPR 6 | 262..294 | 6/31 (19%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG1124 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||