DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment BBS4 and ttc32

DIOPT Version :9

Sequence 1:	NP_610636.1	Gene:	BBS4 / 36167	FlyBaseID:	FBgn0033578	Length:	486	Species:	Drosophila melanogaster
Sequence 2:	NP_001020691.1	Gene:	ttc32 / 100004012	ZFINID:	ZDB-GENE-041014-158	Length:	136	Species:	Danio rerio

Alignment Length:	122	Identity:	29/122 - (23%)
Similarity:	46/122 - (37%)	Gaps:	30/122 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly   212 ENSEVLIEISVLYLKINETQKAHD---------------RLAEVVSIERKCSPKGL-LAF---GA 257
            ||||         |||  .||||:               :..|..:..|.|:.:.| :|:   |.
Zfish     2 ENSE---------LKI--LQKAHEEFNSKNYKRAEELYTQFIESCTKSRDCNGQDLAIAYNNRGQ 55

  Fly   258 ILQSRNDIDGALSKYSQIANAEPEIAELWNNIGLCFFKKQKFIVAISSLRKSVWLSP 314
            :...|.|...|:..|:...:...:......|.||..::...|..|....|:.:.|:|
Zfish    56 VKYLRVDFYEAMDDYTSAIHINRQFEVPLYNRGLIRYRLGFFKEAEGDFRRVLELNP 112

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
BBS4	NP_610636.1	TPR_12	63..127	CDD:290160
		TPR repeat	68..95	CDD:276809
		TPR_12	97..175	CDD:290160
		TPR repeat	100..130	CDD:276809
		TPR repeat	136..175	CDD:276809
		TPR repeat	179..209	CDD:276809
		TPR_19	190..254	CDD:291240	15/57 (26%)
		TPR repeat	214..242	CDD:276809	10/42 (24%)
		TPR repeat	249..277	CDD:276809	7/31 (23%)
		TPR_11	283..348	CDD:290150	8/32 (25%)
		TPR repeat	283..311	CDD:276809	6/27 (22%)
		TPR repeat	316..346	CDD:276809
		TPR repeat	351..377	CDD:276809
ttc32	NP_001020691.1	TPR_11	9..77	CDD:290150	14/67 (21%)
		TPR repeat	9..33	CDD:276809	4/23 (17%)
		TPR repeat	46..76	CDD:276809	7/29 (24%)
		TPR_11	47..112	CDD:290150	13/64 (20%)
		TPR repeat	81..109	CDD:276809	6/27 (22%)
		TPR_1	84..114	CDD:278916	8/29 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG1124
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900