DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb9g

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_035585.2 Gene:Serpinb9g / 93806 MGIID:1919260 Length:377 Species:Mus musculus


Alignment Length:395 Identity:113/395 - (28%)
Similarity:191/395 - (48%) Gaps:42/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSE 74
            :||.:...||.:|.:.|..:.|..|:..||....||:.:|.:||.|.:|.::...|.|   |..|
Mouse     3 TLSQANGTFAIHLLKVLCQDNPSKNVCYSPMSISSALAMVLLGAKGDTAVQICQALHL---NPDE 64

  Fly    75 ------------VAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAY 127
                        :.||:.:.:           .|.:..||:|....::...|.:..|:|:::|..
Mouse    65 DVHQGFQLLLHNLNKQNNQKY-----------CLTMANRLFVENTCELLPTFKESCLKFYHSEME 118

  Fly   128 SLNYLN-PEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQI 191
            .|::.. .|:|.:.:|.|:.|.|...:.:|.:.:..||.:.:||.|:|:|...|.|.|.:..|:.
Mouse   119 QLSFAEAAEESRQHINMWVSKQTNGKIPDLLSKDSVNSQTRLILANALYFHGTWCKRFEKNRTKE 183

  Fly   192 DDFWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELE---- 252
            ..|.||.::...|.||.:.....:...|::::|:|.:|:|..:|..:::||.....:.::|    
Mouse   184 MPFKINKKETRPVQMMWREDTLFHAYVKEIQAQVLVMPYEGIDLNFVVLLPDEGVDISKVENNLT 248

  Fly   253 -EKLGQLDMNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTP 316
             |||......|...::   |..|.:|||:::...|:...||.:||.:|||..:||||.   |.|.
Mouse   249 FEKLTAWTKPEFMNRT---EFHVYLPKFQLQEDYDMNSLLQHLGILNVFDGSKADLSG---MSTK 307

  Fly   317 QK--ISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAI--RDRKNVYFVG 377
            :.  :||..||..:.|.|.|.|.|..:.|:...|...||.:.|.||.||:|.|  |...::.|.|
Mouse   308 ENLCLSEFAHKCVVEVNEEGTEAAAASAVKFIFLCSGPDPETFCADHPFLFFIMHRTTNSILFCG 372

  Fly   378 HFVKP 382
            .|..|
Mouse   373 RFSSP 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 109/382 (29%)
Serpinb9gNP_035585.2 SERPIN 4..377 CDD:294093 112/392 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 211 1.000 Domainoid score I2787
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 215 1.000 Inparanoid score I3599
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.870

Return to query results.
Submit another query.