DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINB11

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001357404.1 Gene:SERPINB11 / 89778 HGNCID:14221 Length:392 Species:Homo sapiens


Alignment Length:400 Identity:110/400 - (27%)
Similarity:199/400 - (49%) Gaps:37/400 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSE 74
            |||.:.:.|..::|:.||......|:..|......|:::|.:||.|::.::|..  :|..|:..:
Human     3 SLSTANVEFCLDVFKELNSNNIGDNIFFSSLSLLYALSMVLLGARGETEEQLEK--VLHFSHTVD 65

  Fly    75 VAKQHAESWTDECSCAKKG-------------------VALRLVTRLYVNEEEKIRTDFNDMALE 120
            ..|   ..:.|...|::.|                   ..|.:..|||..:.......:...:.:
Human    66 SLK---PGFKDSPKCSQAGRIHSEFGVEFSQINQPDSNCTLSIANRLYGTKTMAFHQQYLSCSEK 127

  Fly   121 FFNAEAYSLNY-LNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIF 184
            ::.|...:::: .:.|::.|.:|.|:|..|...|.|||.....:..|.::|||:::|:.:|...|
Human   128 WYQARLQTVDFEQSTEETRKTINAWVENKTNGKVANLFGKSTIDPSSVMVLVNAIYFKGQWQNKF 192

  Fly   185 PQQLTQIDDFWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLP 249
            ..:.|....|.::..:.:.|.||.|||.|:....|:.:.|:|:||:..:.|:|:|:||..|..|.
Human   193 QVRETVKSPFQLSEGKNVTVEMMYQIGTFKLAFVKEPQMQVLELPYVNNKLSMIILLPVGIANLK 257

  Fly   250 ELEEKLGQLDMNEVAAKSLM--KEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFE 312
            ::|::|.....:|..:.|.|  :||:|.:|:|::|...:|...|:.:|:..:|:..:||||.:  
Human   258 QIEKQLNSGTFHEWTSSSNMMEREVEVHLPRFKLETKYELNSLLKSLGVTDLFNQVKADLSGM-- 320

  Fly   313 MKTPQK---ISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIR--DRKN 372
              :|.|   :|:|.||.:|:|:|.|.|.| .|......:|..|.|..|||:.||:|.||  ....
Human   321 --SPTKGLYLSKAIHKSYLDVSEEGTEAA-AATGDSIAVKSLPMRAQFKANHPFLFFIRHTHTNT 382

  Fly   373 VYFVGHFVKP 382
            :.|.|....|
Human   383 ILFCGKLASP 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 106/387 (27%)
SERPINB11NP_001357404.1 ovalbumin_like 4..392 CDD:239014 108/397 (27%)
RCL. /evidence=ECO:0000250 341..365 8/24 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.