DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and AT2G35580

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_181101.1 Gene:AT2G35580 / 818123 AraportID:AT2G35580 Length:374 Species:Arabidopsis thaliana


Alignment Length:385 Identity:95/385 - (24%)
Similarity:161/385 - (41%) Gaps:67/385 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NDEV-----PPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAESWTDE 86
            ||.|     |.:|:::|...|.|.       ....:||::.|.|....::|.........:....
plant    25 NDIVLRLTAPLINVILSIIAASSP-------GDTDTADKIVSLLQASSTDKLHAVSSEIVTTVLA 82

  Fly    87 CSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSV-KKVNKWLEKHTF 150
            .|.|..|..:.....|::.:...:...|.|:.|..:.|....:::....|.| ::||.|:||.|.
plant    83 DSTASGGPTISAANGLWIEKTLNVEPSFKDLLLNSYKAAFNRVDFRTKADEVNREVNSWVEKQTN 147

  Fly   151 YTVRNLFTPEVFNSDSSV----ILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIG 211
            ..:.||...   |..|:.    |..|:|||..:|:..|...||:..||.:....::.|..|.   
plant   148 GLITNLLPS---NPKSAPLTDHIFANALFFNGRWDSQFDPSLTKDSDFHLLDGTKVRVPFMT--- 206

  Fly   212 QFRYGESKKLKS-----QILQLPFERS-----NLTMMIILPTAIDGLPELEEKL----GQLDMNE 262
                |.|.:...     :::.|.:.|.     :.:|.|.||...||||.:.|:|    |.|..||
plant   207 ----GASCRYTHVYEGFKVINLQYRRGREDSRSFSMQIYLPDEKDGLPSMLERLASTRGFLKDNE 267

  Fly   263 V--AAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHK 325
            |  :..:::||  :.||:|:.:               ..|:|.:|...  |.:..|  :|...||
plant   268 VLPSHSAVIKE--LKIPRFKFD---------------FAFEASEALKG--FGLVVP--LSMIMHK 311

  Fly   326 VFLNVTEFGCEVAPEAEVQPEVLKKNPDRKF-FKADRPFVFAIRDRKN--VYFVGHFVKP 382
            ..:.|.|.|.:.|..|..:....::.|..|. |.||.||:|.:::.::  |.|:|..:.|
plant   312 SCIEVDEVGSKAAAAAAFRGIGCRRPPPEKHDFVADHPFLFIVKEYRSGLVLFLGQVMDP 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 94/380 (25%)
AT2G35580NP_181101.1 plant_SERPIN 8..371 CDD:238998 94/383 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.