DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpind1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_077358.1 Gene:Serpind1 / 79224 RGDID:619854 Length:479 Species:Rattus norvegicus


Alignment Length:385 Identity:107/385 - (27%)
Similarity:185/385 - (48%) Gaps:41/385 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPV-NMMVSPAGARSAMTLVFMGAGGKSADELRSKL----ILGVSNKSEVAK 77
            ||.||:|.|.|:.... |:.::|.|..:||.::.:|..|::.:|:.|.|    .:..|:|.||..
  Rat   113 FAFNLYRVLKDQATSSDNIFIAPVGISTAMGMISLGLRGETHEEVHSVLHFKDFVNASSKYEVTT 177

  Fly    78 QH--AESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKK 140
            .|  ....|........|..|:.|..||:.::..||.||.....||:.|||...::.:|. .:.|
  Rat   178 IHNLFRKLTHRLFRRNFGYTLQSVNDLYIQKQFPIREDFKAAMREFYFAEAQEADFSDPA-FISK 241

  Fly   141 VNKWLEKHTFYTVRNLFTPEVFNSDSS--VILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRME 203
            .|    .|.....:.|....:.|:||:  ::::|.::|:..|...||.::|...:|.:|.|:.::
  Rat   242 AN----SHILKLTKGLIKEALENTDSATQMMILNCIYFKGAWMNKFPVEMTHNHNFRLNEREVVK 302

  Fly   204 VSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSL 268
            ||||:..|.|.....::|...||||.:. ..::|:|::|..:.|:..||.:|.. .:.|...||:
  Rat   303 VSMMQTKGNFLAANDQELDCDILQLEYV-GGISMLIVIPRKLSGMKTLEAQLTP-QVVERWQKSM 365

  Fly   269 MKEV-DVTIPKFRIECTVDLKVPLQKMGINSVFD-----AGQAD---LSDLFEMKTPQKISEARH 324
            .... :|.:|||::|...:|...|:.|||..:|:     :|.:|   :.|||           :|
  Rat   366 TNRTREVLLPKFKLEKNYNLVEVLKSMGITKLFNKNGNMSGISDQRIIIDLF-----------KH 419

  Fly   325 KVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRKN--VYFVGHFVKP 382
            :..:.|.|.|.:.|....|....|.   .:..|..||||:|.:.:.:.  :.|:|....|
  Rat   420 QSTITVNEEGTQAAAVTTVGFMPLS---TQVRFTVDRPFLFLVYEHRTSCLLFMGRVANP 476

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 106/380 (28%)
Serpind1NP_077358.1 HCII 44..477 CDD:239002 107/385 (28%)
2 X 11 AA approximate repeats, Asp/Glu-rich (acidic) (hirudin-like) 55..79
Glycosaminoglycan-binding site. /evidence=ECO:0000250 172..192 5/19 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.