DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpine3

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_006252257.2 Gene:Serpine3 / 691375 RGDID:1585042 Length:413 Species:Rattus norvegicus


Alignment Length:376 Identity:79/376 - (21%)
Similarity:158/376 - (42%) Gaps:41/376 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82
            ||.:|:::...|....|.::|||....::.::...|.|.:..:|..  .||.:.:....::...:
  Rat    35 FALHLYQSAAAETNGTNFVISPASVSLSLEILQFAARGNTGWQLAE--ALGYTVQDPRVREFLHT 97

  Fly    83 WTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLEK 147
            .......:.:|:.:.|...|::.....:...|.:....:.|:.....::..|..:..:.:|.   
  Rat    98 VYITLHNSSQGIGMELACTLFMQTGTSLSPCFVEQVSRWANSSLELADFSEPNTTTMEASKG--- 159

  Fly   148 HTFYTVRNLFTPEVFNSDSSVI------------LVNSLFFRAKWNKIFPQQLTQIDDFWINPRQ 200
                |.|    |.......|.:            :|:::.|::.|.:.|.....|...|......
  Rat   160 ----TTR----PSTGEGPGSPLWGRAGALSTQLSIVSTMTFQSSWQQRFSSVALQPLPFTCAHGL 216

  Fly   201 RMEVSMMRQIGQFRYGESKKL---KSQILQLPFERSNLTMMIILP----TAIDGL-PELEEKLGQ 257
            .::|..|.|:.:..||:.:..   |..:|:|.:.....:::::||    |.:|.: |.|..::..
  Rat   217 VLQVPAMHQVAEVSYGQFQDAAGHKVDVLELLYLGRVASLLLVLPQDKGTPLDHIEPHLTARVIH 281

  Fly   258 LDMNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEA 322
            |    ...:.....:||.:|:|||:...|||..|:..||..:||..:|:|..: ..:....:||.
  Rat   282 L----WTTRLKRARMDVFLPRFRIQNQFDLKSILRSWGITDLFDPLKANLKGI-SGRDGFYVSEV 341

  Fly   323 RHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRKNV 373
            .||..:.::|.|.:......|   :|.:......|||||||:|.:|:...|
  Rat   342 THKAKMELSEEGTKSCAATAV---LLLRRSRTPAFKADRPFIFLLREHNTV 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 79/376 (21%)
Serpine3XP_006252257.2 serpin 20..400 CDD:422956 79/376 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.