DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina1f

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_080963.2 Gene:Serpina1f / 68348 MGIID:1915598 Length:411 Species:Mus musculus


Alignment Length:367 Identity:77/367 - (20%)
Similarity:161/367 - (43%) Gaps:42/367 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAESW--------TDECSCA 90
            |::.||....:|::::.:|:.|..:..:...|....:...| |:.|...|        |:|.|..
Mouse    67 NILFSPIRVIAAISMLSLGSNGNLSKHILETLRFNKTGLPE-AEIHKCFWYLLHSIHQTEEPSSL 130

  Fly    91 KKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWL----EKHTFY 151
            :.|      :.::::::......|.....:.::::..|:|:.:...:..::|.::    :|....
Mouse   131 QTG------SSVFIHQDLTSVDKFVKGVKDLYHSDMISINFTDSSQAKTQINNYVMEKSQKEIVN 189

  Fly   152 TVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIGQFRYG 216
            .|:||      .||:.:.:||.:.:.||.:..|..:..::.|:.:.....::|.|:..:......
Mouse   190 IVKNL------ESDTFLAVVNYIIWNAKLDSNFGCRSVKVKDYHLGYGMTIKVPMIHNMAMHYLF 248

  Fly   217 ESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSLMKEVDVTIPKFRI 281
            ..:.|.|.:|.|.....|.....|:|.. ..:.::|:.|.......:..:.|.:.||:.||:..:
Mouse   249 RVEDLSSTVLMLTLLTGNFATYFIIPDP-GKMQKVEQSLTYPHFRRMRRQLLTRLVDLEIPELSL 312

  Fly   282 ECTVDLKVPLQKMGINSVFDAG--QADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAPEAEVQ 344
            ..|.||:..:..:||..||::|  .:|::|     |.||..:...|..|.:.|.|.:.:..:   
Mouse   313 SETHDLESMMSLLGITYVFNSGTNSSDMND-----TLQKSFKVVSKAVLTIDEKGSKPSTNS--- 369

  Fly   345 PEVLKK--NPDRKFFKADRPFVFAIRDRKN--VYFVGHFVKP 382
              ..||  :.|....:.:|||:..|:|..|  ..|:|..|.|
Mouse   370 --CFKKLGSTDMGRMQLNRPFLIFIQDHTNDVPLFLGRVVNP 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 75/362 (21%)
Serpina1fNP_080963.2 Serpin 48..409 CDD:278507 76/365 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.