DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina12

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_080811.1 Gene:Serpina12 / 68054 MGIID:1915304 Length:413 Species:Mus musculus


Alignment Length:386 Identity:99/386 - (25%)
Similarity:189/386 - (48%) Gaps:22/386 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGTTAPSLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKL-IL 67
            |...|..|:...:.|...|.:.|....|..|:.:||....:|.:::.:||...:.:|:|... ..
Mouse    41 GKKDARQLARHNMEFGFKLLQRLASNSPQGNIFLSPLSISTAFSMLSLGAQNSTLEEIREGFNFK 105

  Fly    68 GVSNKSEVAKQH--AESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLN 130
            .:||....|..|  ......|....|    :.|...|:::::.:.:..|.::|...::|:....|
Mouse   106 EMSNWDVHAAFHYLLHKLNQETEDTK----MNLGNALFMDQKLRPQQRFLNLAKNVYDADMVLTN 166

  Fly   131 YLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFW 195
            :.:.|::.|.:|:::.:.|...::|:.  :..:..:.:||.|.::||.:|...|..:.|:.::|:
Mouse   167 FQDLENTQKDINRYISQKTHSRIKNMV--KSIDPGTVMILTNYIYFRGRWQYEFDPKQTKEEEFF 229

  Fly   196 INPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDM 260
            |...:.::|.||.|.|.:......:|...||::|: |.|:|...:||.  :|..:|.|:..|.|:
Mouse   230 IEKGKTVKVPMMFQRGLYDMAYDSQLSCTILEIPY-RGNITATFVLPD--NGKLKLLEQGLQADI 291

  Fly   261 NEVAAKSLMKE--VDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEAR 323
             ....|||:.:  |||.:||.||..|.::|..|.::||:.:|:. ..||:.:...:: .|:.||.
Mouse   292 -FAKWKSLLSKRVVDVWVPKLRISSTYNMKKVLSRLGISKIFEE-NGDLTRISSHRS-LKVGEAV 353

  Fly   324 HKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDR--KNVYFVGHFVKP 382
            ||..|.:.|.|.|.|..:..| .:..:.|  :..|.||||:..|.:.  .::.|:.....|
Mouse   354 HKAELKMDEKGMEGAAGSGAQ-TLPMETP--RHMKLDRPFLMMIYENFMPSMVFLARIYDP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 95/367 (26%)
Serpina12NP_080811.1 alpha-1-antitrypsin_like 51..408 CDD:239011 95/371 (26%)
Reactive center loop. /evidence=ECO:0000250|UniProtKB:Q8IW75 364..382 5/20 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.