DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina5

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001231668.1 Gene:Serpina5 / 65051 RGDID:619817 Length:442 Species:Rattus norvegicus


Alignment Length:383 Identity:101/383 - (26%)
Similarity:185/383 - (48%) Gaps:12/383 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ASGGTTAPSLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLI 66
            :|.|....|.|..   ||..|:|||..|.|..|:..||.....::.::.:|:|.|:..::...|.
  Rat    70 SSVGAVGTSRSRD---FAFRLYRALASEAPGQNVFFSPMSVSMSLGMLSLGSGLKTKAQILEGLG 131

  Fly    67 LGV-SNKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLN 130
            |.: ..:.::..:..:....:.|....|:.|.|.:.|:.:....||..|.......:.::.:|.|
  Rat   132 LSLQQGQEDMLHKGFQQLLQQFSQPSDGLQLSLGSALFTDPAVHIRDHFLSAMKTLYMSDMFSTN 196

  Fly   131 YLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFW 195
            :.|||.:.|::|.::.|.|...:.:|.  :..:|...:::||.:||:|||...|....|...|:.
  Rat   197 FGNPESAKKQINDYVAKKTNGKIVDLI--KDLDSTHVMVVVNYIFFKAKWQTAFSSTNTHKMDYH 259

  Fly   196 INPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDG-LPELEEKLGQLD 259
            :.|::.::|.||.:...:.|...:.:...::.:|:: .|...:.|||:  :| :..:|:.|.:..
  Rat   260 VTPKKTIQVPMMNREDIYSYILDQNISCTVVGIPYQ-GNTFALFILPS--EGKMKRVEDGLDERT 321

  Fly   260 MNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARH 324
            :.........:::|:.:|||.||.|..|:..|.|:||..:|.. .||||.|.: .|..|:||..|
  Rat   322 LRNWLKMFTKRQLDLYLPKFSIEGTYKLEKILPKLGIQDIFTT-HADLSGLTD-HTNIKLSEMVH 384

  Fly   325 KVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRKNVYFVGHFVKP 382
            |..:.|.|.|...|....:...:....|.....:..|||:..|.|..|:||:|..::|
  Rat   385 KSMVEVDESGTTAAASTGILFTLRSARPSSLKVEFTRPFLVVIMDGTNLYFIGKVIQP 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 96/362 (27%)
Serpina5NP_001231668.1 alpha-1-antitrypsin_like 81..439 CDD:239011 96/367 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.