DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and LOC569077

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001188383.1 Gene:LOC569077 / 569077 -ID:- Length:384 Species:Danio rerio


Alignment Length:398 Identity:120/398 - (30%)
Similarity:200/398 - (50%) Gaps:44/398 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 LSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEV 75
            :|.:..:||.:|::||:......|:..||....:.:::|::||.|.:|.|:  :.:|.:|:.|:|
Zfish     4 VSRANSLFALDLYQALSASSAEGNIFFSPLSISAVLSMVYLGARGDTAAEM--ERVLSLSSVSDV 66

  Fly    76 AKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN-PEDSVK 139
             ..|.||.....:.......|||..|||..:......:..|..::.::||..:::::. .|.|.:
Zfish    67 -HSHFESLISSINSPSASYILRLANRLYGEKSFSFLPECLDSTMKLYHAELQTVDFIGASEGSRQ 130

  Fly   140 KVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEV 204
            .:|||:||.|...:|:|..|.:..:.:.:.|||:::|:.||...|..:.|:...|.||.::...|
Zfish   131 LINKWVEKQTENKIRDLLKPGMVTTMTRLALVNAIYFKGKWTHTFQAKYTREMAFKINQKESHPV 195

  Fly   205 SMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILP----TAIDGLPELE-----EKLGQLDM 260
            .||.|:.:..:....:.|.|:|:||:.:..|:|:|:||    ...|.|.:||     |||  ||.
Zfish   196 RMMHQLNKLPFRCLPEYKLQVLELPYIQQELSMLILLPDETKDGSDPLLKLEKELTLEKL--LDW 258

  Fly   261 NEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLS------DLFEMKTPQKI 319
            ...........|.|.:|||::|....|...|:|||::|||...:|||:      .||       :
Zfish   259 TNRDKMDTQGAVIVHLPKFKLEIESCLSETLEKMGMSSVFQETKADLTGMGSNGGLF-------V 316

  Fly   320 SEARHKVFLNVTEFGCEVAPEAEV--------QPEVLKKNPDRKFFKADRPFVFAIRDR--KNVY 374
            |...||.|::|:|.|.|.|....|        :||      .|.:|.||.||:|.||..  .|:.
Zfish   317 SAVIHKAFVDVSEEGTEAAAATCVYIITSYVPRPE------PRYYFTADHPFMFFIRHNPSNNIL 375

  Fly   375 FVGHFVKP 382
            |:|.:..|
Zfish   376 FLGRYRSP 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 118/386 (31%)
LOC569077NP_001188383.1 SERPIN 5..383 CDD:294093 119/395 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.