DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINI1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001116224.1 Gene:SERPINI1 / 5274 HGNCID:8943 Length:410 Species:Homo sapiens


Alignment Length:403 Identity:109/403 - (27%)
Similarity:193/403 - (47%) Gaps:41/403 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MASGGTTAPSLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKL 65
            ||:|.|......|...|...|..||..::   .|::.||.....||.::.:||.|.:..|:|..:
Human    15 MATGATFPEEAIADLSVNMYNRLRATGED---ENILFSPLSIALAMGMMELGAQGSTQKEIRHSM 76

  Fly    66 -ILGVSNKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSL 129
             ...:.|..|.:  ..:.:::..:..:....:::...|:|.....:..:|..|..::|||....:
Human    77 GYDSLKNGEEFS--FLKEFSNMVTAKESQYVMKIANSLFVQNGFHVNEEFLQMMKKYFNAAVNHV 139

  Fly   130 NYLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDF 194
            ::.........:|||:|.:|...|::|.:|..|::.:.:.|:|:::|:..|...|..:.|:...|
Human   140 DFSQNVAVANYINKWVENNTNNLVKDLVSPRDFDAATYLALINAVYFKGNWKSQFRPENTRTFSF 204

  Fly   195 WINPRQRMEVSMMRQIGQFRYGESKKLKS------QILQLPFERSNLTMMIILPTAIDGLPELEE 253
            ..:....:::.||.|.|:|.|||.....:      |:|::|:|...::||::|......|..| |
Human   205 TKDDESEVQIPMMYQQGEFYYGEFSDGSNEAGGIYQVLEIPYEGDEISMMLVLSRQEVPLATL-E 268

  Fly   254 KLGQLDMNEVAAKSLMKE-VDVTIPKFRIECTVDLKVPLQKMGINSVF--DAGQADLSDLFEMKT 315
            .|.:..:.|..|.|:.|: |:|.:|:|.:|..:|||..|:.:||..:|  ||....|||..|:  
Human   269 PLVKAQLVEEWANSVKKQKVEVYLPRFTVEQEIDLKDVLKALGITEIFIKDANLTGLSDNKEI-- 331

  Fly   316 PQKISEARHKVFLNVTEFGCEVAP---------EAEVQPEVLKKNPDRKFFKADRPFVFAIRDRK 371
              .:|:|.||.||.|.|.|.|.|.         .|.:.|:|:          .|.||.|.||:|:
Human   332 --FLSKAIHKSFLEVNEEGSEAAAVSGMIAISRMAVLYPQVI----------VDHPFFFLIRNRR 384

  Fly   372 --NVYFVGHFVKP 382
              .:.|:|..:.|
Human   385 TGTILFMGRVMHP 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 102/381 (27%)
SERPINI1NP_001116224.1 neuroserpin 23..410 CDD:239003 105/395 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.