DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINB9

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_004146.1 Gene:SERPINB9 / 5272 HGNCID:8955 Length:376 Species:Homo sapiens


Alignment Length:382 Identity:114/382 - (29%)
Similarity:196/382 - (51%) Gaps:17/382 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSE 74
            :||.:...||..|.:.|..:.|..|:..||....||:.:|.:||.|.:|.::...|.|   |..|
Human     3 TLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSL---NTEE 64

  Fly    75 VAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN-PEDSV 138
            ...:..:|...|.:.|.....||...||:..:..:..:.|.:..|:|::||...|:::. .|:|.
Human    65 DIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESR 129

  Fly   139 KKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRME 203
            |.:|.|:.|.|...:..|......::::.::|||:::|:.|||:.|.:..|:...|.||..::..
Human   130 KHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRP 194

  Fly   204 VSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDG--LPELEEKLGQLDMNEVAAK 266
            |.||.|...|:.....::::|:|:||:.|..|:::::||.  ||  |..:|:.|....:......
Human   195 VQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPD--DGVELSTVEKSLTFEKLTAWTKP 257

  Fly   267 SLMK--EVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLN 329
            ..||  ||:|.:|||:::...|::..|:.:||...|..|:||||.: ..:....:|:..||.|:.
Human   258 DCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADLSAM-SAERDLCLSKFVHKSFVE 321

  Fly   330 VTEFGCEVAPEAE--VQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFVKP 382
            |.|.|.|.|..:.  |..|...::..|  |.||.||:|.||..:  ::.|.|.|..|
Human   322 VNEEGTEAAAASSCFVVAECCMESGPR--FCADHPFLFFIRHNRANSILFCGRFSSP 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 110/369 (30%)
SERPINB9NP_004146.1 SERPIN 4..376 CDD:320777 113/379 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.