DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINB6

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_011512974.1 Gene:SERPINB6 / 5269 HGNCID:8950 Length:454 Species:Homo sapiens


Alignment Length:385 Identity:105/385 - (27%)
Similarity:182/385 - (47%) Gaps:39/385 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82
            ||.||.:.|..: ...|:..||.....|:.:|:|||.|.:|.::...|....|.......|..:|
Human    89 FALNLLKTLGKD-NSKNVFFSPMSMSCALAMVYMGAKGNTAAQMAQILSFNKSGGGGDIHQGFQS 152

  Fly    83 WTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNP-EDSVKKVNKWLE 146
            ...|.:.......||:..||:..:.....:.|.|...:|:.||...|::::. |.|.|.:|.|:.
Human   153 LLTEVNKTGTQYLLRMANRLFGEKSCDFLSSFRDSCQKFYQAEMEELDFISAVEKSRKHINTWVA 217

  Fly   147 KHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIG 211
            :.|...:..|.:|...:..:.::|||:::||..|::.|.::.|:...|.::..:...|.||.:..
Human   218 EKTEGKIAELLSPGSVDPLTRLVLVNAVYFRGNWDEQFDKENTEERLFKVSKNEEKPVQMMFKQS 282

  Fly   212 QFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKL--------GQLDMNEVAAKSL 268
            .|:.....::.:|||.||:....|.|:|:||.....|..:|::|        .:|||.:      
Human   283 TFKKTYIGEIFTQILVLPYVGKELNMIIMLPDETTDLRTVEKELTYEKFVEWTRLDMMD------ 341

  Fly   269 MKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEF 333
            .:||:|::|:|::|.:.|::..|:.:|:...|:.|:||.|.:  .:|...:|:..||.|:.|.|.
Human   342 EEEVEVSLPRFKLEESYDMESVLRNLGMTDAFELGKADFSGM--SQTDLSLSKVVHKSFVEVNEE 404

  Fly   334 GCEVAPE---------AEVQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFVKP 382
            |.|.|..         |...|.          |.||.||:|.|:..|  .:.|.|.|..|
Human   405 GTEAAAATAAIMMMRCARFVPR----------FCADHPFLFFIQHSKTNGILFCGRFSSP 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 103/380 (27%)
SERPINB6XP_011512974.1 PAI-2 82..454 CDD:239013 104/383 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.