DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINA4

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:397 Identity:97/397 - (24%)
Similarity:186/397 - (46%) Gaps:34/397 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 GTTAPSLSASP--IVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLIL 67
            |..:|||..:|  ..||...:..:..|.|..|:..||....:|..::.:||...|    ||:::.
Human    80 GEGSPSLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHS----RSQILE 140

  Fly    68 GVS-NKSEVAK-------QHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNA 124
            |:. |.:|:::       ||.   ....:....|:..|:.:.|:::...|....|.:..:..:.|
Human   141 GLGFNLTELSESDVHRGFQHL---LHTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEA 202

  Fly   125 EAYSLNYLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLT 189
            :.:..|:.:...:::.:|..::|.|...:.:|.:.  ...|..::|||.::|:|.|.|.|....|
Human   203 KLFHTNFYDTVGTIQLINDHVKKETRGKIVDLVSE--LKKDVLMVLVNYIYFKALWEKPFISSRT 265

  Fly   190 QIDDFWINPRQRMEVSMMRQIGQFR-YGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEE 253
            ...||:::....:.|.||.|..:.. |...:.|...:|::.: :.:.|:..|||.. ..:.|:||
Human   266 TPKDFYVDENTTVRVPMMLQDQEHHWYLHDRYLPCSVLRMDY-KGDATVFFILPNQ-GKMREIEE 328

  Fly   254 KL-GQLDM---NEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMK 314
            .| .::.|   |.:..::..|::::.:|||.|..:..|...|.::|...:| :..||||.:.:. 
Human   329 VLTPEMLMRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLF-SKWADLSGITKQ- 391

  Fly   315 TPQKI--SEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAI--RDRKNVYF 375
              ||:  |::.||..|:|.|.|.|.|.......:......:|...:.:|||:..|  ...::|.|
Human   392 --QKLEASKSFHKATLDVDEAGTEAAAATSFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLF 454

  Fly   376 VGHFVKP 382
            :|..|.|
Human   455 LGKVVDP 461

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 90/377 (24%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 90/381 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.