DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINA1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_000286.3 Gene:SERPINA1 / 5265 HGNCID:8941 Length:418 Species:Homo sapiens


Alignment Length:385 Identity:110/385 - (28%)
Similarity:195/385 - (50%) Gaps:32/385 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKS 73
            |:|:.    ||.:|:|.|..:....|:..||....:|..::.:|....:.||:...|..   |.:
Human    52 PNLAE----FAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNF---NLT 109

  Fly    74 EVAKQHAESWTDEC--SCAKKGVALRLVT--RLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNP 134
            |:.:........|.  :..:....|:|.|  .|:::|..|:...|.:...:.:::||:::|:.:.
Human   110 EIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDT 174

  Fly   135 EDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPR 199
            |::.|::|.::||.|...:.:|.  :..:.|:...|||.:||:.||.:.|..:.|:.:||.::..
Human   175 EEAKKQINDYVEKGTQGKIVDLV--KELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQV 237

  Fly   200 QRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDG-LPELEEKLGQLDMNEV 263
            ..::|.||:::|.|.....|||.|.:|.:.: ..|.|.:..||.  :| |..||.:|    .:::
Human   238 TTVKVPMMKRLGMFNIQHCKKLSSWVLLMKY-LGNATAIFFLPD--EGKLQHLENEL----THDI 295

  Fly   264 AAKSLMKE----VDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARH 324
            ..|.|..|    ..:.:||..|..|.|||..|.::||..||..| ||||.:.| :.|.|:|:|.|
Human   296 ITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNG-ADLSGVTE-EAPLKLSKAVH 358

  Fly   325 KVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAI--RDRKNVYFVGHFVKP 382
            |..|.:.|.|.|.|....::...:...|:.||   ::||||.:  ::.|:..|:|..|.|
Human   359 KAVLTIDEKGTEAAGAMFLEAIPMSIPPEVKF---NKPFVFLMIEQNTKSPLFMGKVVNP 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 106/371 (29%)
SERPINA1NP_000286.3 alpha-1-antitrypsin_like 55..412 CDD:239011 106/377 (28%)
RCL 368..392 6/26 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.