DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINA5

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:390 Identity:104/390 - (26%)
Similarity:184/390 - (47%) Gaps:31/390 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GGTTAPSLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILG 68
            |.|.|||   |...|..:|:|||....|..::..||.....::.::.:|||..:..::...|.|.
Human    37 GATVAPS---SRRDFTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLN 98

  Fly    69 VSNKSEVAKQHA-ESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYL 132
            :...||...... :....|.:..:.|..|.|...|:.:....::..|.......:.|:.:..|:.
Human    99 LQKSSEKELHRGFQQLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFR 163

  Fly   133 NPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWIN 197
            :...::|::|.::.|.|...:.:|.  :..:|::.||:||.:||:|||...|..:.||..||::.
Human   164 DSAGAMKQINDYVAKQTKGKIVDLL--KNLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVT 226

  Fly   198 PRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNE 262
            ....:.|.||.:..|:.|...:.|..:::.:|:: .|.|.:.|||:        |.|:.|:: |.
Human   227 SETVVRVPMMSREDQYHYLLDRNLSCRVVGVPYQ-GNATALFILPS--------EGKMQQVE-NG 281

  Fly   263 VAAKSLMK--------EVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKI 319
            ::.|:|.|        ::::.:|||.||.:..|:..|..:||::|| ...||||.:......| :
Human   282 LSEKTLRKWLKMFKKRQLELYLPKFSIEGSYQLEKVLPSLGISNVF-TSHADLSGISNHSNIQ-V 344

  Fly   320 SEARHKVFLNVTEFGCEVAPEAEV--QPEVLKKNPDRKFFKADRPFVFAIRDRKNVYFVGHFVKP 382
            ||..||..:.|.|.|...|.....  .....:.|..|..|  :|||:..|.| .|:.|:|...:|
Human   345 SEMVHKAVVEVDESGTRAAAATGTIFTFRSARLNSQRLVF--NRPFLMFIVD-NNILFLGKVNRP 406

  Fly   383  382
            Human   407  406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 97/371 (26%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 98/375 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6025
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.960

Return to query results.
Submit another query.