DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINE1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001373389.1 Gene:SERPINE1 / 5054 HGNCID:8583 Length:492 Species:Homo sapiens


Alignment Length:387 Identity:93/387 - (24%)
Similarity:159/387 - (41%) Gaps:74/387 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRS------------------- 63
            |...:|:.:.......|::.||.|..|.:.::.:..||::..::::                   
Human    38 FGVRVFQQVAQASKDRNVVFSPYGVASVLAMLQLTTGGETQQQIQAAMGFKIDDKGMAPALRHLY 102

  Fly    64 KLILGVSNKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYS 128
            |.::|..||.|:      |.||               .::|..:.|:...|.......|.:....
Human   103 KELMGPWNKDEI------STTD---------------AIFVQRDLKLVQGFMPHFFRLFRSTVKQ 146

  Fly   129 LNYLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDD 193
            :::...|.:...:|.|::.||...:.||......:..:.::|||:|:|..:|...||...|....
Human   147 VDFSEVERARFIINDWVKTHTKGMISNLLGKGAVDQLTRLVLVNALYFNGQWKTPFPDSSTHRRL 211

  Fly   194 FWINPRQRMEVSMMRQIGQFRYGESKKLKS---QILQLPFERSNLTMMIILPTAIDGLPELEEKL 255
            |..:....:.|.||.|..:|.|.|......   .||:||:....|:|.|..|.      |.|..|
Human   212 FHKSDGSTVSVPMMAQTNKFNYTEFTTPDGHYYDILELPYHGDTLSMFIAAPY------EKEVPL 270

  Fly   256 GQLDMNEVAA------KSLMKEVD--VTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFE 312
            ..| .|.::|      |..|..:.  :.:|||.:|..|||:.||:.:|:..:|...|||.:.|.:
Human   271 SAL-TNILSAQLISHWKGNMTRLPRLLVLPKFSLETEVDLRKPLENLGMTDMFRQFQADFTSLSD 334

  Fly   313 MKTPQKISEARHKVFLNVTEFG------CEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIR 368
            .: |..:::|..||.:.|.|.|      ..|...|.:.||.:         ..||||:|.:|
Human   335 QE-PLHVAQALQKVKIEVNESGTVASSSTAVIVSARMAPEEI---------IMDRPFLFVVR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 93/387 (24%)
SERPINE1NP_001373389.1 serpinE1_PAI-1 29..393 CDD:381007 93/387 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.