DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Spn42Da

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524955.2 Gene:Spn42Da / 49805 FlyBaseID:FBgn0265137 Length:424 Species:Drosophila melanogaster


Alignment Length:372 Identity:104/372 - (27%)
Similarity:202/372 - (54%) Gaps:15/372 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAE 81
            :|:.|::..|:.:.|..|::.||...::...:..:||..::|.:|...|.|..|:..::    |.
  Fly    47 LFSINVYGKLSGQKPGENIVFSPFSIQTCAAMARLGAENETATQLDQGLGLASSDPEQI----AH 107

  Fly    82 SWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLE 146
            |:....:..:....||:..:::|.:..::|.:|:.:..:.|.:.|.|:::.....:...:|.|:|
  Fly   108 SFHQVLAAYQDSQILRIANKIFVMDGYQLRQEFDQLLSKQFLSAAQSVDFSKNVQAAATINNWVE 172

  Fly   147 KHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIG 211
            :.|.:.:::|...:|.||:|.::|||::.|:..|...|.:.||:.|.|.::..:.::|.||....
  Fly   173 QRTNHLIKDLVPADVLNSESRLVLVNAIHFKGTWQHQFAKHLTRPDTFHLDGERTVQVPMMSLKE 237

  Fly   212 QFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSLMKEVDVTI 276
            :|||.:...|.:..|:||::.|:|:|:|:||....|||.|||||....::::.......:|.:.:
  Fly   238 RFRYADLPALDAMALELPYKDSDLSMLIVLPNTKTGLPALEEKLRLTTLSQITQSLYETKVALKL 302

  Fly   277 PKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAPEA 341
            |:|:.|..|:|....||:|::.:| :.||:...:.:...|.|:|...||.|:.|.|.|.|.|  |
  Fly   303 PRFKAEFQVELSEVFQKLGMSRMF-SDQAEFGKMLQSPEPLKVSAIIHKAFIEVNEEGTEAA--A 364

  Fly   342 EVQPEVLKK----NPDR--KFFKADRPFVFAIRDRKNV-YFVGHFVK 381
            .....|.:|    :|:.  :|| ||.||.:.:..:|:: .|.|..|:
  Fly   365 ATGMAVRRKRAIMSPEEPIEFF-ADHPFTYVLVHQKDLPLFWGSVVR 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 103/367 (28%)
Spn42DaNP_524955.2 SERPIN 45..408 CDD:238101 103/368 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449407
Domainoid 1 1.000 218 1.000 Domainoid score I2586
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
87.850

Return to query results.
Submit another query.