DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and serpinb1l1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001009892.2 Gene:serpinb1l1 / 494155 ZFINID:ZDB-GENE-040715-5 Length:384 Species:Danio rerio


Alignment Length:392 Identity:119/392 - (30%)
Similarity:204/392 - (52%) Gaps:29/392 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSE 74
            ||||:...|:.|||:.::......|:..||....||:.:|.:||.|.:||::..  :||.::::.
Zfish     3 SLSAANTQFSLNLFKKISGGNASGNVFYSPVSISSALAMVSLGAKGNTADQMFK--VLGFNSQAH 65

  Fly    75 --VAKQHA--ESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLN-P 134
              |.:.|:  :.:..|.:..:....|.|..|||..:..::...|.:....:::|....::::| .
Zfish    66 QPVEQIHSNFKKFMSELNKPEAPYVLSLANRLYGEQTYQLIEKFLNDTKRYYDAGLEKVDFINKS 130

  Fly   135 EDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPR 199
            ||:...:|.|:||:|...:::|......::.:.::|||:::|:..|.:.||::.|:...|.:|..
Zfish   131 EDARVNINTWVEKNTQEKIKDLLPSGAIDAMTRLVLVNAIYFKGNWEEKFPKEATRDGVFRLNKN 195

  Fly   200 QRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAID----GLPELEEKLGQLDM 260
            |...|.||.|..:|..|..:::||.:|:||:...||:|:||||..|:    ||.:||..|....:
Zfish   196 QTKPVKMMHQKAEFPSGYIEEMKSHVLELPYAGKNLSMLIILPDEIEDETTGLQKLERALTYEKL 260

  Fly   261 NEVAAKSLM--KEVDVTIPKFRIECTVDLKVPLQKMGINSVFD------AGQADLSDLFEMKTPQ 317
            .|.....:|  :||.|::|||:.|.|.|:|..|..||:..|||      .|.:..:||.      
Zfish   261 MEWTKPEVMHQREVQVSLPKFKTEQTYDMKSLLVSMGMEDVFDPQKVNLTGMSSSNDLV------ 319

  Fly   318 KISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDR--KNVYFVGHFV 380
             :|:|.||.|:.|.|.|.|.|.......:::...|... |.||.||:|.||..  |::.|.|...
Zfish   320 -LSKAIHKAFVEVNEEGTEAAAATAAIEKLMCYIPPLS-FNADHPFLFFIRHNPTKSILFYGRLC 382

  Fly   381 KP 382
            .|
Zfish   383 SP 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 114/379 (30%)
serpinb1l1NP_001009892.2 PAI-2 4..384 CDD:239013 117/389 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 218 1.000 Domainoid score I2586
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.