DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Spn100A

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:364 Identity:92/364 - (25%)
Similarity:149/364 - (40%) Gaps:56/364 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 KSADELRSKLILGVSNKSEVAKQH--AESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMA 118
            :|..|..:.|.:....|.::|.:.  ||...::.|..::.....|.....|.||||:.......|
  Fly   259 ESQPEETTTLSVEKQEKPDMAAEENPAEKQQNKRSDQEESQIKNLEENETVQEEEKLAKIMAAPA 323

  Fly   119 LEFFNAEAYSLNYLNPEDSVKKVNK--------WLEKH-------------------TFYTVRNL 156
            |.....|...|.....|::||...|        .||.|                   |.....|.
  Fly   324 LTAGEPEKVRLPLQKLENAVKTAAKDGADEIMLALESHLPSVSRVNGARSLFQQDDITSALSANS 388

  Fly   157 FTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDD-FWINPRQRMEVSMMRQIGQFRYGESKK 220
            .|.....|.|.::|.|.|::|..|...|.|.....|: |::.....::..||...|:|:..:..:
  Fly   389 ITGRSAGSKSKMLLFNGLYYRGSWANPFYQLRDGSDEFFFMTNEDAVKAPMMHARGKFQVADLPQ 453

  Fly   221 LKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSLMKEVDVTIPKFRIECTV 285
            :|:::|.||:|.|...:.|:||...:||.::..:|...|......:..|||:.:::|||::|.|.
  Fly   454 VKARVLSLPYETSRYALCIVLPDETEGLSDVISQLQTSDFLLAKKQFQMKELHISMPKFQVEETS 518

  Fly   286 DLKVPLQKMGINSVFDAGQADLSDLFEMKTPQ-KISEARHKVFLNVTEFGCE------------- 336
            ..:..|::||:..||...:|.||.|.|  .|. .:.|....|.:.|.|.|..             
  Fly   519 RSEAMLKQMGLKKVFSRTEAQLSLLSE--DPDVHVDEIVQFVNVRVDEGGSSANSLSAATMQART 581

  Fly   337 ------VAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRD 369
                  |.|..|.:||:    |..:.|:.:|||.:.|.|
  Fly   582 PSVESTVLPVPEPEPEL----PGVERFEVNRPFAYFIVD 616

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 92/364 (25%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 67/243 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.