DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Spn77Ba

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001287128.1 Gene:Spn77Ba / 40234 FlyBaseID:FBgn0262057 Length:450 Species:Drosophila melanogaster


Alignment Length:395 Identity:95/395 - (24%)
Similarity:177/395 - (44%) Gaps:40/395 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALNDEVPPVN--MMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNK 72
            |:|.....||.:|.:.::.||...|  .|:||....|.:.|::.|:.|::.::|:..|.:.|  :
  Fly    71 SISQGVQDFALDLLQRISVEVEKANKDFMISPFSVWSLLVLLYEGSEGETRNQLKKSLRINV--E 133

  Fly    73 SEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDS 137
            .|..:...:.|:...:.....:.:..:..:|..:...|:.::.| |::.:|.:...:::.:| ||
  Fly   134 DEKLRGAYKVWSSFLNITTSTIEVATLQAIYTGKGYPIKNNYRD-AIQNYNVQPMEVDFYSP-DS 196

  Fly   138 VKKVNKWLEKHTFYTVRNLFTPEVFNSD---SSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPR 199
            |.::|    :.|..|.|.|....:...|   :.:.|::||:|:.:|...|.:.||:.:.|:....
  Fly   197 VIQIN----EDTNRTTRGLIPYTILPQDVYGAKMFLLSSLYFKGQWKFPFNKTLTREEPFFSESG 257

  Fly   200 QRM-EVSMMRQIGQFRY-GESKKLKSQILQLPF-ERSNLTMMIILPTAIDGLPELEEKLGQLDMN 261
            :.: ::.||.|...|.| ...:.|...:|:||: .:..|.|:::||.....|.::...|..|.:.
  Fly   258 EVIGKIPMMVQEANFAYVSNVEGLDGYVLELPYGTQDRLAMIVVLPKRGFKLNDVANNLKALGLR 322

  Fly   262 EVAAK--------SLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADL----SDLFEMK 314
            .:..:        |...||:|.:|||.......||..|.:|||..:||...|:|    |.||...
  Fly   323 PILQRLAAFRNRASEDNEVEVMMPKFVTATDFTLKGVLIQMGIRDLFDENTANLDRMSSGLFAKL 387

  Fly   315 TPQKISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRKN--VYFVG 377
            ..       |...:.|.|.|....  |..:..:..|....||. .:|||.:.|.::..  :.|.|
  Fly   388 VV-------HSTKIIVDEQGTTAG--AVTEAALANKATPPKFL-LNRPFQYMIVEKATGLLLFAG 442

  Fly   378 HFVKP 382
            ....|
  Fly   443 QVRNP 447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 92/382 (24%)
Spn77BaNP_001287128.1 SERPIN 75..444 CDD:238101 92/386 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446347
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
54.950

Return to query results.
Submit another query.