DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Acp76A

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_524153.1 Gene:Acp76A / 40078 FlyBaseID:FBgn0015586 Length:388 Species:Drosophila melanogaster


Alignment Length:373 Identity:82/373 - (21%)
Similarity:154/373 - (41%) Gaps:64/373 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 DEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLIL--GVSNKSEVAKQHAESW---TDEC 87
            |...|.|.::|.......:..:......:|.::|...||:  |.|.    |:|....|   ..:.
  Fly    34 DRYTPENFVLSVLNIEMILFEIHAAKAVESNNDLERSLIINFGYSE----ARQEVLDWGLRYKKA 94

  Fly    88 SCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNY-LNPEDSVKKVNKWLEKHTFY 151
            |.||..:|.::.....:...:|:|. .|::.:.  :|:.|.:.. :.|.   |.:::||..|...
  Fly    95 SSAKFQMANKVAVSQKLPLSQKLRL-VNEVLMT--SAKKYDVTKDVRPS---KLMDEWLSSHLDG 153

  Fly   152 TVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWIN-------PRQRMEVSMMRQ 209
            .:.|....:..|:..:::.::.:.....|...|.   ::|:.:::|       .:....|.||..
  Fly   154 VLANFVQEKKLNAGENIVAISGMTVTPLWASHFQ---SEINRYFVNNPGTGYASKDPTCVPMMHS 215

  Fly   210 IGQFRYGESKKLKSQILQLPFERSNLTMMIILP----TAIDGLPELEEKLGQLDMNEVAAKSLMK 270
            :..|....:.:.|.  :.:||..:||.|:|:||    |..|.|..|..:: .::.|:      .|
  Fly   216 LSSFETMSTDEAKG--IYIPFSSANLGMLILLPRKGVTCKDILDNLNNQI-NVEYND------HK 271

  Fly   271 EVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEF-- 333
            :|.:.:|.|:.:  .|..:.....|||         :.|.|      |.|..:.|..:.:..|  
  Fly   272 DVHLLLPIFKEK--FDYNIAKFFNGIN---------IEDTF------KDSAFKSKAKIKINNFRV 319

  Fly   334 --GCEVAP--EAEVQPEVLKKNPDRKFFKADRPFVFAIRDRKNVYFVG 377
              |....|  ..||..::  .....:.|:.:|||||.|:|:.|||.||
  Fly   320 NHGIRFQPILRLEVVDDI--DTGKTETFEVNRPFVFVIKDKINVYAVG 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 82/373 (22%)
Acp76ANP_524153.1 SERPIN 22..367 CDD:294093 82/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.