DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and serpine2

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:367 Identity:98/367 - (26%)
Similarity:174/367 - (47%) Gaps:38/367 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NMMVSPAGARSAMTLVFMGAGGKSADELRSKL---------ILGVSNKSEVAKQHAESWTDECSC 89
            |:::||.|..|.:.::..||.|.:..:|.:.|         :|...:||...|.:|:..|     
Zfish    49 NVLLSPHGVASVLGMLLPGAHGDTRRQLLNGLKYKKNGPYKMLRKLHKSLTTKSNADIVT----- 108

  Fly    90 AKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLEKHTFYTVR 154
                    :...|:.||...::.||.....|.|..|::|::|.:||.:.:.:|.|::..|...:.
Zfish   109 --------IANALFPNEGFSMKEDFLSANRENFLCESHSVDYSDPEAAAQSINDWVKNSTKGQIP 165

  Fly   155 NLFTPEVFNSD-SSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIGQFRYGES 218
            ::.|.::|::. :.::.|||:||:..|...|..|.|:...|........:|.||.|:..|..|::
Zfish   166 SVVTADMFDTALTRLVAVNSIFFKGLWKSRFQPQSTKPRSFTAGDGNTYKVPMMSQLSVFNMGQA 230

  Fly   219 KKLKSQ---ILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAA-KSLM--KEVDVTIP 277
            .....|   :::||:..::::|.|.|||. |..| |...|..:..|.:.: ..||  :.:.:.:|
Zfish   231 STPDGQKYIVIELPYHGNSMSMFIALPTE-DSTP-LSSILPHISTNTIQSWTKLMNPRRMRLLMP 293

  Fly   278 KFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAPEAE 342
            ||.:|..:||:.||:.:||..:||..:||...|.....  .:|:|..|..:.|.|.|.:.:....
Zfish   294 KFTVEQELDLETPLKALGIKDIFDQNKADFRHLSSESI--YVSKALQKAKIEVNEDGTKASATTS 356

  Fly   343 VQPEVLKKNPDRKFFKADRPFVFAIRDRKN--VYFVGHFVKP 382
            |   :|.......:...||||:|.||...:  :.|.|...||
Zfish   357 V---ILHARSSPPWVTVDRPFLFLIRHNSSGTILFAGQINKP 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 96/362 (27%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 96/365 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.