DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINA2

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:383 Identity:97/383 - (25%)
Similarity:183/383 - (47%) Gaps:28/383 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 SLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSE 74
            |.:.:.:.|  :|::.|.|.....|::|:|.....|..::.:|....:..|:...|.:.::...|
Human    54 SYNVTDLAF--DLYKELADLSQTSNVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPE 116

  Fly    75 VAKQHAESWTDEC------SCAKKGVALRLVT--RLYVNEEEKIRTDFNDMALEFFNAEAYSLNY 131
             ||.|      ||      :.::....|:|.|  .|:||:..|:...|.:...:.:::||.|:|:
Human   117 -AKIH------ECFQQVLQALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINF 174

  Fly   132 LNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWI 196
            .:.|::.:::|.::||.|...|.:|.  :....|:|:.||:.:.|..||...|..:...::.|.:
Human   175 RDTEEAKEQINNYVEKRTGRKVVDLV--KHLKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHV 237

  Fly   197 NPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMN 261
            :.:..:.|.|:..:|:|.....::|.|.:|...:. .|.|...|||.. ..:.:|||||....:.
Human   238 DDKTIIRVPMINHLGRFDIHRDRELSSWVLAQHYV-GNATAFFILPDP-KKMWQLEEKLTYSHLE 300

  Fly   262 EVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKV 326
            .:.....::.:::..||..|..|..||..|:.:||..:| :.:||||.: ..:.|.|:|:|.|..
Human   301 NIQRAFDIRSINLHFPKLSISGTYKLKRVLRNLGITKIF-SNEADLSGV-SQEAPLKLSKAVHVA 363

  Fly   327 FLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRKNVY--FVGHFVKP 382
            .|.:.|.|.|......::.:...|.....|   :|||:..|:|....:  |:|..|.|
Human   364 VLTIDEKGTEATGAPHLEEKAWSKYQTVMF---NRPFLVIIKDDITNFPLFIGKVVNP 418

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 94/370 (25%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 95/373 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.