DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb3b

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_941373.1 Gene:Serpinb3b / 383548 MGIID:2683293 Length:387 Species:Mus musculus


Alignment Length:391 Identity:107/391 - (27%)
Similarity:209/391 - (53%) Gaps:30/391 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAK 77
            |:.:.||..::|.|.:.  ..|:..||....:|:.::.:||.|.:  |::.:.:|.....::...
Mouse     6 AADVKFAVEMYRQLRES--DKNIFYSPISMMTALAMLQLGAKGNT--EIQIEKVLQFIETTKKTT 66

  Fly    78 QHAESWTDECSCAKKGVALRLVTRLYVNEEEK----------------IRTDFNDMALEFFNAEA 126
            :.:|...||.:..::  ..:|:|:|..:.::.                ::|...|:. |::.|:.
Mouse    67 EKSEHCDDEENVHEQ--FQKLITQLNKSNDDYDLKAANSIYGAKGFPFLQTFLEDIK-EYYQAKV 128

  Fly   127 YSLNYLN-PEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQ 190
            .||::.: .|:|.||:|.|:|..|...:::||.....:|.:.::|||:::|:.:||:.|.:..|:
Mouse   129 ESLDFEHATEESEKKINSWVESKTNGKIKDLFPSGSLSSSTILVLVNAVYFKGQWNRKFNENHTR 193

  Fly   191 IDDFWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKL 255
            .:.||:|......|.||:|..:|.:.....:.:||:::|::..:|:|.::||..||||.:|||:|
Mouse   194 EEKFWLNKNTSKPVQMMKQRNKFNFSFLGDVHAQIVEIPYKGKDLSMFVLLPMEIDGLKQLEEQL 258

  Fly   256 GQLDMNE-VAAKSL-MKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQK 318
            ....:.| :.|::: :.|:.:::|:|::|...||:|||:.||:...||..:||.|.:..: ....
Mouse   259 TTDKLLEWIKAENMHLTELYLSLPRFKVEEKYDLQVPLEHMGMVDAFDPQKADFSGMSSI-PGLV 322

  Fly   319 ISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAI--RDRKNVYFVGHFVK 381
            :|:..||.|:.|.|.|.|.|....|:..| :.....:.|..|.||:|.|  |...::.|.|....
Mouse   323 VSKVLHKSFVEVNEEGTEAAAATGVEVSV-RSAQIAEDFCCDHPFLFFIIHRMTNSILFFGRICS 386

  Fly   382 P 382
            |
Mouse   387 P 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 105/381 (28%)
Serpinb3bNP_941373.1 SERPIN 6..387 CDD:294093 106/389 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.