DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and AT1G62160

DIOPT Version :10

Sequence 1:NP_610633.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:177 Identity:47/177 - (26%)
Similarity:71/177 - (40%) Gaps:47/177 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 QILQLPFERS------NLTMMIILPTAIDGLPELEEKL----GQLDMNEVAAKSLMKEVD-VTIP 277
            ::|:||:.:.      |.:|...||.....|.:|.:::    |.||.:....:   .||| ..||
plant    71 KVLRLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTPGFLDSHTPRER---VEVDEFRIP 132

  Fly   278 KFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISE-----ARHKVFLNVTEFGCEV 337
            ||:||...:         .:|||...:.|:|  |..|...:|.|     |....|:: .|.||..
plant   133 KFKIEFGFE---------ASSVFSDFEIDVS--FYQKALIEIDEEGTEAAAATAFVD-NEDGCGF 185

  Fly   338 APEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFVKP 382
            ....:              |.||.||:|.||:.:  .|.|.|....|
plant   186 VETLD--------------FVADHPFLFLIREEQTGTVLFAGQIFDP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_610633.1 serpin42Dd-like_insects 13..382 CDD:381070 46/175 (26%)
AT1G62160NP_176407.2 serpin 1..218 CDD:476815 46/175 (26%)

Return to query results.
Submit another query.