DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and AT1G62160

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_176407.2 Gene:AT1G62160 / 3767608 AraportID:AT1G62160 Length:220 Species:Arabidopsis thaliana


Alignment Length:177 Identity:47/177 - (26%)
Similarity:71/177 - (40%) Gaps:47/177 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 QILQLPFERS------NLTMMIILPTAIDGLPELEEKL----GQLDMNEVAAKSLMKEVD-VTIP 277
            ::|:||:.:.      |.:|...||.....|.:|.:::    |.||.:....:   .||| ..||
plant    71 KVLRLPYRQGRDNTNRNFSMYFYLPDKKGELDDLLKRMTSTPGFLDSHTPRER---VEVDEFRIP 132

  Fly   278 KFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISE-----ARHKVFLNVTEFGCEV 337
            ||:||...:         .:|||...:.|:|  |..|...:|.|     |....|:: .|.||..
plant   133 KFKIEFGFE---------ASSVFSDFEIDVS--FYQKALIEIDEEGTEAAAATAFVD-NEDGCGF 185

  Fly   338 APEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRK--NVYFVGHFVKP 382
            ....:              |.||.||:|.||:.:  .|.|.|....|
plant   186 VETLD--------------FVADHPFLFLIREEQTGTVLFAGQIFDP 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 46/172 (27%)
AT1G62160NP_176407.2 SERPIN <43..218 CDD:294093 46/175 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.