DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb6b

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_038951899.1 Gene:Serpinb6b / 364705 RGDID:1310452 Length:388 Species:Rattus norvegicus


Alignment Length:409 Identity:111/409 - (27%)
Similarity:182/409 - (44%) Gaps:58/409 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKS 73
            |.|.|:. .||.||.:.|.:: ...|::.||....|.:.:|||||.|.:|.::...|.|      
  Rat     3 PLLEANG-TFAFNLLKTLGED-SSKNVLFSPLSISSGLAMVFMGAKGTTAHQMIQALSL------ 59

  Fly    74 EVAKQHAESWTDECS-----------------CAKKGV--ALRLVTRLYVNEEEKIRTDFNDMAL 119
                       |:||                 ..|.|.  .|:...||:..:...|...|.|...
  Rat    60 -----------DKCSGRGSRDVHQGFQSLLAKVNKTGTQYLLKTANRLFGEKTFDILASFKDACR 113

  Fly   120 EFFNAEAYSLNYLN-PEDSVKKVNKWLEKHT-----------FYTVRNLFTPEVFNSDSSVILVN 172
            :|:.||...|::.. ||.|.:.:|.|:.|.|           ...:..|.:....|:::.::|||
  Rat   114 KFYEAEMEELDFKGAPEQSRQHINTWVAKKTEGQSISLNWNSQKKITELLSSGSVNANTPLVLVN 178

  Fly   173 SLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTM 237
            :::|:..|.|.|.::.||...|.:...:...|.||.:...|:....:::.:.||.||:..:.|.|
  Rat   179 AIYFKGNWKKQFNKEDTQEMPFKVTKNEEKPVKMMFKKSTFKMTYVEEISTTILLLPYVGNELNM 243

  Fly   238 MIILPTAIDGLPELEEKLGQLDMNEVAAKSLM--KEVDVTIPKFRIECTVDLKVPLQKMGINSVF 300
            :|:||.....|..:|:::......|..:...|  :||:|.:|||::|...|:|..|.::|:...|
  Rat   244 IIMLPDEHIELRMVEKEITYKKFIEWTSLDKMEEREVEVFLPKFKLEENHDMKDVLHRLGMTDAF 308

  Fly   301 DAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVF 365
            :.|.||.|.: ..|....:|:..||.|:.|.|.|.|.|.............|   :|.|:.||:|
  Rat   309 EQGMADFSGI-ASKEGLFLSKVIHKSFVEVNEEGTEAAAATAANVTFRCMVP---YFCANHPFLF 369

  Fly   366 AIR-DRKN-VYFVGHFVKP 382
            .|: .|.| :.|.|.|..|
  Rat   370 FIQHSRTNGIVFCGRFSSP 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 106/395 (27%)
Serpinb6bXP_038951899.1 serpin 1..388 CDD:422956 110/407 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.