DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina11

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001008776.1 Gene:Serpina11 / 362774 RGDID:1359239 Length:462 Species:Rattus norvegicus


Alignment Length:430 Identity:101/430 - (23%)
Similarity:199/430 - (46%) Gaps:69/430 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 APSL-SASPIV--FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGV 69
            ||:. ..:|.:  ||..|::.|.:|:|. |::.||....|.:.|:.:||...:..::...|...:
  Rat    44 APAYHKVTPTITNFALRLYKQLAEEIPG-NILFSPVSLSSTVALLSLGAHADTQAQILQSLGFNL 107

  Fly    70 SNKSEVAKQHA--ESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYL 132
            : ::..|..|.  :|...........:.|:|...|:::.:.|.:..|.|.|.|.:.|.|:|.|:.
  Rat   108 T-ETPAADIHRGFQSLLHTLDLPSPKLELKLGHSLFLDRQLKPQQRFLDSAKELYGALAFSANFT 171

  Fly   133 NPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQ-QLTQIDDFWI 196
            ....:.:::|..:.|.|:..|.... || |:.|:.::|:|.:||:|||...|.: |..:.:.|::
  Rat   172 EAAATGQQINDLVRKQTYGQVVGCL-PE-FDRDTLMVLLNYIFFKAKWKHPFDRYQTRKQESFFV 234

  Fly   197 NPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILP---------TAIDGLPEL- 251
            :.|.::.:.||||....|:...::....:||:.:..:.| ::::||         .|:.  ||. 
  Rat   235 DQRLQLRIPMMRQKEMHRFLYDQEASCTVLQIEYSGTAL-LLLVLPDPGKMQQVEAALQ--PETL 296

  Fly   252 -------------------------------EEKLGQLDMNEVAAKSLMKEVDVTIPKFRIECTV 285
                                           :.::|:|.:..:........:|:.:|:|.:..|.
  Rat   297 RRWGQRFLPRKAQAGGAGNGGLHWDRVNEFPQNRVGKLSLKHLQMTQTWSLLDLHLPRFSVSATY 361

  Fly   286 DLKVPLQKMGINSVFDAGQADLSDLFEM--KTPQKISEARHKVFLNVTEFGCEVAPEAEV--QPE 346
            :|:..|..:|::|:||. :||||.:...  ||..::|   ||..:::.|.|.|.|..:.:  ||.
  Rat   362 NLEEILPLVGLSSLFDV-EADLSGIMGQLNKTVSRVS---HKAVVDMNEKGTEAAAASGLLSQPP 422

  Fly   347 VLKKN--PDRKFFKADRPFVFAIRD--RKNVYFVGHFVKP 382
            .|...  |...|   :|||:..:.:  .:::.|:|..|.|
  Rat   423 SLNMTSAPHAHF---NRPFLLLLWEVTTQSLLFLGKVVNP 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 96/412 (23%)
Serpina11NP_001008776.1 alpha-1-antitrypsin_like 53..456 CDD:239011 96/416 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.