DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Spn28Da

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001036345.1 Gene:Spn28Da / 34082 FlyBaseID:FBgn0051902 Length:384 Species:Drosophila melanogaster


Alignment Length:372 Identity:113/372 - (30%)
Similarity:190/372 - (51%) Gaps:23/372 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82
            |.:.|:|:...:....|::.||......|:::.|||.|.:|:|||:.|.| ..:|..||..:.:.
  Fly    17 FTKQLYRSFLQDNKQYNIIASPLCVEIGMSMILMGADGNTANELRTALNL-PEDKKNVATIYDKL 80

  Fly    83 WTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLEK 147
            .| :....||...|.|..||:|||...:...:|.:..:.|.|||.::...:...:...:|.|:..
  Fly    81 LT-KLERGKKVAILHLANRLFVNETIGVNKRYNKLVNKHFRAEAEAIKLADRLKAAWAINDWVLD 144

  Fly   148 HTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIGQ 212
            .|...|:::..|.....|.|.:::|:.||:..|...|.:..|:...|:::...::.|:||.|:|:
  Fly   145 QTLDNVKDIIIPSDLTPDESAVMINAAFFKGYWKTRFDKMNTKPKVFYVSKSYQVNVNMMSQVGR 209

  Fly   213 FRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELE---EKLGQLDMNEVAAKSLMKEVDV 274
            |:...|  ...||::|||..|||:|:|:||.....|.:.|   |...|:.:.|:       :|.|
  Fly   210 FKMRTS--TIDQIIELPFAYSNLSMVIVLPKDNGSLTQAEATIESYPQIVLTEM-------DVHV 265

  Fly   275 TIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAP 339
            .:|||:|:..::|...|:.|||..:|:: .:|:|.|.. ::..:||:..||.|:.:.|.|.. |.
  Fly   266 QLPKFKIDFRMELVETLKSMGIQDLFNS-SSDISVLLN-QSGTRISQVVHKAFIEIDEEGGS-AG 327

  Fly   340 EAEVQPEVLKKNPDRK----FFKADRPFVFAIRDRKNVYFVGHFVKP 382
            .|...|  ::...|..    .|..:.||||.|||..|:||.|..|.|
  Fly   328 SASASP--IRGLSDYATSVVTFTVNSPFVFMIRDDDNIYFRGRVVDP 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 111/367 (30%)
Spn28DaNP_001036345.1 SERPIN 16..369 CDD:238101 111/367 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446402
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
65.950

Return to query results.
Submit another query.