DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpina7

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:395 Identity:104/395 - (26%)
Similarity:183/395 - (46%) Gaps:46/395 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 PSLSASPIVFARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKS 73
            ||::|.   ||.:|:|.|:.|.|.:|:..||.....|:.::..|:|..:..::..  :||. |.:
Mouse    54 PSINAD---FAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILE--VLGF-NLT 112

  Fly    74 EVAKQHAESWTDECSCA----KKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNP 134
            :......:.......|:    |..:.|::...:::.::.|....|.|.....:..|.:|.::.|.
Mouse   113 DTPVTELQQGFQHLICSLNFPKNELELQMGNAVFIGQQLKPLAKFLDDVKTLYETEVFSTDFSNV 177

  Fly   135 EDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLT-QIDDFWINP 198
            ..:..|:|.::||.|...:..|.  :....:..:||||.:.|||:|...|....| :..:|.::.
Mouse   178 SAAQHKINSYVEKQTKGKIVGLI--QGLKLNIIMILVNYIHFRAQWANPFRVSKTEESSNFSVDK 240

  Fly   199 RQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEV 263
            ...::|.||.|:.|:.:....:|...:||:.:..:.|.:.:        ||    |.|.::..|.
Mouse   241 STTVQVPMMHQLEQYYHYVDMELNCTVLQMDYSENALALFV--------LP----KEGHMEWVEA 293

  Fly   264 A--AKSLMK--------EVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQK 318
            |  :|:|.|        .|::.:|||.|..|.||...|||||:...| |..||...:.| .:..|
Mouse   294 AMSSKTLKKWNYLLQKGWVELFVPKFSISATYDLGSTLQKMGMRDAF-AESADFPGITE-DSGLK 356

  Fly   319 ISEARHKVFLNVTEFGCEVAPEAEV----QPEVLKKNPDRKFFKADRPFVFAIRDR--KNVYFVG 377
            :|.|.||..|::.|.|.:.....||    |.||...:|   ..:.||.|:..|.::  ::|.|:|
Mouse   357 LSYAFHKAVLHIGEEGTKEGASPEVGSLDQQEVPPLHP---VIRLDRAFLLMILEKRTRSVLFLG 418

  Fly   378 HFVKP 382
            ..|.|
Mouse   419 KLVNP 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 99/381 (26%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 99/386 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.