DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and SERPINA9

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_783866.3 Gene:SERPINA9 / 327657 HGNCID:15995 Length:417 Species:Homo sapiens


Alignment Length:371 Identity:94/371 - (25%)
Similarity:185/371 - (49%) Gaps:13/371 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVA-KQHAE 81
            ||..|:|.|..|.|..|:..||....:::.::.:||...:..::...|...:::..|.| .|..:
Human    51 FAFRLYRRLVLETPSQNIFFSPVSVSTSLAMLSLGAHSVTKTQILQGLGFNLTHTPESAIHQGFQ 115

  Fly    82 SWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLE 146
            ......:...|.:.|::.:.|:|.:|.:::.:|.......:.||.:|.::.||..:..::|..::
Human   116 HLVHSLTVPSKDLTLKMGSALFVKKELQLQANFLGNVKRLYEAEVFSTDFSNPSIAQARINSHVK 180

  Fly   147 KHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQID-DFWINPRQRMEVSMMRQI 210
            |.|...|.::.  :..:..::::|||.:||:|||.|.|..:.|:.: .|.:..:..:.|.||.|.
Human   181 KKTQGKVVDII--QGLDLLTAMVLVNHIFFKAKWEKPFHPEYTRKNFPFLVGEQVTVHVPMMHQK 243

  Fly   211 GQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKLGQLDMNEVAAKSLMKEVDVT 275
            .||.:|...:|...:||:.: :.:.....:||:. ..:.:||:.|....:.:.:.....:.::|.
Human   244 EQFAFGVDTELNCFVLQMDY-KGDAVAFFVLPSK-GKMRQLEQALSARTLRKWSHSLQKRWIEVF 306

  Fly   276 IPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEARHKVFLNVTEFGCEVAPE 340
            ||:|.|..:.:|:..|.||||.:|||. .||.|.:.:..:.| :|:|.||..|:|:|.|.| |..
Human   307 IPRFSISASYNLETILPKMGIQNVFDK-NADFSGIAKRDSLQ-VSKATHKAVLDVSEEGTE-ATA 368

  Fly   341 AEVQPEVLKKNPDRKFFKA--DRPFVFAIRDR--KNVYFVGHFVKP 382
            |.....:::......:|..  :|.|:..|.::  ..:.|:|....|
Human   369 ATTTKFIVRSKDGPSYFTVSFNRTFLMMITNKATDGILFLGKVENP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 93/366 (25%)
SERPINA9NP_783866.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.