DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and serpina1

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_017207927.1 Gene:serpina1 / 322701 ZFINID:ZDB-GENE-030131-1421 Length:433 Species:Danio rerio


Alignment Length:388 Identity:104/388 - (26%)
Similarity:188/388 - (48%) Gaps:52/388 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRAL--NDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKL--------------- 65
            ||.:|::.|  |.:....|:..||.|...|::|:.:||...:..::.|.|               
Zfish    73 FAFSLYKKLASNPDGQGKNIFFSPVGISMALSLLAVGAKASTLSQIYSGLGYSALTPEQVNEGYE 137

  Fly    66 -ILGVSNKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSL 129
             :|.:...|:.|.|..         |..|||:|        :..|:...|...|..::|:||:.:
Zfish   138 HLLHMLGHSQDAMQLE---------AGAGVAIR--------DGFKVVDQFLKDAQHYYNSEAFGV 185

  Fly   130 NYLNPEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQIDDF 194
            ::..||.:..::||::.:.|...:.|:.  :..::|:.::|:|.::||.||.|.|..:||...||
Zfish   186 DFSKPEIAAAEINKFIARKTHDKITNMV--KDLDADTVMMLINYMYFRGKWEKPFDAKLTHKADF 248

  Fly   195 WINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDG-LPELEEKLGQL 258
            .::....::|.||::.|::...:....::.::.:|: :.|.:|||:||.  || :.||||.:.:.
Zfish   249 KVDQDTTVQVDMMKRTGRYDIYQDPVNQTTVMMVPY-KGNTSMMIVLPD--DGKMKELEESICRH 310

  Fly   259 DMNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQKISEAR 323
            .:.....|.....||:.:|||.|..|..|...|:.||:...|: .:||.|.:.| :...|:|:..
Zfish   311 HLKNWHDKLFRSSVDLFMPKFSISATSKLDGILKDMGMTDAFN-DKADFSGMTE-EVKVKVSQVL 373

  Fly   324 HKVFLNVTEFGCEVA--PEAEVQPEVLKKNPDRKFFKADRPF-VFAIRD-RKNVYFVGHFVKP 382
            |:..::|.|.|.|.|  ...|:.|..|   ||....  :||| |..:.| ..::.|:|....|
Zfish   374 HQAVMSVDEKGTEAAAITTIEIMPMSL---PDTVIL--NRPFLVLIVEDSTMSILFMGKITNP 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 103/383 (27%)
serpina1XP_017207927.1 alpha-1-antitrypsin_like 69..428 CDD:239011 103/383 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.