DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpine3

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:373 Identity:81/373 - (21%)
Similarity:162/373 - (43%) Gaps:44/373 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82
            ||.:|:|:...|....|.::|||....::.::..||.|.:..:|...|...|.:.......||..
Mouse    35 FALHLYRSAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAGALGYTVQDPRVKEFLHAVY 99

  Fly    83 WTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKWLEK 147
            .|...|  .:||.:.|...|::.....:...|.:....:.|:...:.::..|..:..:.:|...:
Mouse   100 TTRHNS--SQGVGMELACTLFMQTGTSLSPCFVEQVSRWANSSLEAADFSEPNSTTTEASKVTSR 162

  Fly   148 HTFYTVRNLFTPEVFNSD---SSVILVNSLFFRAKWNKIF-----PQQLTQIDDFWINPRQRMEV 204
            .:  |.....:|....:|   :.:.:::::.|::.|.|.|     |...|.....      .::|
Mouse   163 QS--TGEGPDSPLWGRADALSTQLSIMSTMTFQSTWQKRFSVVLQPLPFTHAHGL------VLQV 219

  Fly   205 SMMRQIGQFRYGESKKLKSQ---ILQLPFERSNLTMMIILP----TAIDGL-PELEEKLGQLDMN 261
            ..|.|:.:..||:.:.....   :|:|.:.....:::::||    |.:|.: |.|..::    ::
Mouse   220 PAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVASLLLVLPQDKGTPLDHIEPHLTARV----LH 280

  Fly   262 EVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADL-----SDLFEMKTPQKISE 321
            ....:.....:||.:|:|:|:...|:|..|:..||..:||..:|:|     .|.|      .:|:
Mouse   281 LWTTRLKRARMDVFLPRFKIQNQFDVKSILRSWGITDLFDPLKANLKGISGQDGF------YVSQ 339

  Fly   322 ARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRD 369
            ..||..:.::|.|...:....|   :|.:......|||||||:|.:|:
Mouse   340 LTHKAKMELSEEGTRSSAATAV---LLLRRSRTSAFKADRPFIFLLRE 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 81/373 (22%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 81/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.