DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Spn75F

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001036614.1 Gene:Spn75F / 317912 FlyBaseID:FBgn0052203 Length:356 Species:Drosophila melanogaster


Alignment Length:388 Identity:75/388 - (19%)
Similarity:150/388 - (38%) Gaps:86/388 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 FARNLFRALNDEVPPVNMMVSPAGARSAMTLVFMGAGGKSADELRSKLILGVSNKSEVAKQHAES 82
            |..||.:.|:......|.:.||...|.|:.|:::.....:..:|.|.|.|...|:.|:.....| 
  Fly    22 FEINLTKQLSKGRLARNFVYSPIAIRQALGLLYLSKDNVTDQQLESALQLTGLNQEEIISLFKE- 85

  Fly    83 WTDECSCAKKGVALRLVT---RLYVNEEEKIRTDFNDMALEFFNAEAYSLNYLNPEDSVKKVNKW 144
                   |::.||....|   |:|::.:.....:...:: |....|..::.:...:.:..::.||
  Fly    86 -------AREKVAQEQFTMGNRIYLSPDYNASPNITQLS-ENLGVEVKNMTFSGDQSAASEIKKW 142

  Fly   145 LEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKW-----------------NK---IFPQQLT 189
            |.|.......|||.....:..:.::.|..:.:...|                 ||   ::..|:.
  Fly   143 LNKWIGKAGGNLFGKNDISQTTQIVAVQGMSYSCVWKNRETALTNRTFTLLRQNKKPFVYTTQMM 207

  Fly   190 QID---DFWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLP-- 249
            ..:   ||:.|.:.|.                       :.:||:.|::.|:::||.     |  
  Fly   208 YTEAPMDFFNNDQVRG-----------------------VMVPFKNSDMGMLVLLPR-----PRY 244

  Fly   250 ELEEKLGQLDMNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMK 314
            ..::.|..||..........|:..:.:|||::..:|||.:.|:.:||.::|....|     ...|
  Fly   245 STQQILYSLDTILKIKLRRSKKTHLFLPKFKVSESVDLNMALKALGIQNLFTNTNA-----ANFK 304

  Fly   315 TPQKISEARHKVFLNVTEFGCEVAPEAEVQPEVLKKNPDRKFFKADRPFVFAIRDRKNVYFVG 377
            ........:::|.:.:     :|..:.:          ||..: .:|.|||.::|:..:|.:|
  Fly   305 QYNSFDADQNRVLMTI-----DVGDDFD----------DRVVY-VNRGFVFVVKDKSTIYMIG 351

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 75/388 (19%)
Spn75FNP_001036614.1 SERPIN 21..353 CDD:294093 75/388 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449417
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.