DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and RGD1562844

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:286 Identity:79/286 - (27%)
Similarity:146/286 - (51%) Gaps:12/286 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KLILGVSNKSEVAKQHA--ESWTDECSCAKKGVALRLVTRLYVNEEEKIRTDFNDMALEFFNAEA 126
            |::|..|:.|:....|.  :....:.:.:::..:||:...::|::..::...|.:..|.|:|:|.
  Rat     2 KILLCASHLSKKGDIHRGFQLLFKKLNKSERYFSLRMANGIFVDKTCEVLPTFKESCLRFYNSEM 66

  Fly   127 YSLNYLN-PEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFFRAKWNKIFPQQLTQ 190
            ..|::.. .|:|.|.||.|:.|.|...:..|...:..:..:.::|||:|:.:|.|.:.|.:..|:
  Rat    67 EQLSFAEAAEESRKHVNTWVSKQTEGKIPELLPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTR 131

  Fly   191 IDDFWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIILPTAIDGLPELEEKL 255
            ...|.||..:...|.||.|.|.|.|...|::.:.:|.:|::...|..:::||.....:.::||:|
  Rat   132 EMPFKINKNETRPVQMMYQEGIFCYKYVKEVPASLLMIPYKGDELCFLVLLPDESVDISKVEEEL 196

  Fly   256 GQLDMNEVAAKSLMK--EVDVTIPKFRIECTVDLKVPLQKMGINSVFDAGQADLSDLFEMKTPQK 318
            ....:........|.  .|:|.:|||::|...|||..||::||...|:..:||||.:    .|::
  Rat   197 TFEKLTAWTQPDTMSYTHVEVFLPKFKLEEDYDLKSLLQRLGIVDAFEETKADLSAM----APER 257

  Fly   319 ---ISEARHKVFLNVTEFGCEVAPEA 341
               :|:..||..:.|.|.|.|.|..|
  Rat   258 NLCVSKFVHKSVVEVNEKGTEAAAAA 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 79/286 (28%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.