DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn47C and Serpinb9d

DIOPT Version :9

Sequence 1:NP_001163116.1 Gene:Spn47C / 36163 FlyBaseID:FBgn0033574 Length:382 Species:Drosophila melanogaster
Sequence 2:NP_001100821.1 Gene:Serpinb9d / 306890 RGDID:1308725 Length:337 Species:Rattus norvegicus


Alignment Length:355 Identity:96/355 - (27%)
Similarity:164/355 - (46%) Gaps:38/355 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVFMGAGGKSADELRSKLILGVSNKSEVAKQHAESWTDECSCAKKGVALRLVTRLYVNEEEKIRT 112
            :|.:||.|.:|.::...|.|......::.|.. :......:..|....||:..||:.....|:..
  Rat     1 MVLLGAKGDTAVQISQALNLNKHPDEDIHKDF-QLLLHNLNKPKSHYCLRIANRLFAENTCKLVP 64

  Fly   113 DFNDMALEFFNAEAYSLNYLN-PEDSVKKVNKWLEKHTFYTVRNLFTPEVFNSDSSVILVNSLFF 176
            .:.:..|.|:|:|...|::.. .|:|.|.:|.|:.|.|...:..|.:.:...|::.:|:||:|:|
  Rat    65 TYKESCLRFYNSEIEQLSFAKAAEESRKHINTWVSKQTEGKIPELLSSDSVGSETKLIMVNALYF 129

  Fly   177 RAKWNKIFPQQLTQIDDFWINPRQRMEVSMMRQIGQFRYGESKKLKSQILQLPFERSNLTMMIIL 241
            :..|...|.::.|....|.||.::...|.||.|...|.....|::::|||.:|:....::.|::|
  Rat   130 QGSWLHCFDKEFTMEMPFKINKKETKPVQMMWQEETFDVAYVKEIQAQILVMPYRGMEMSFMVLL 194

  Fly   242 PTAIDGLPELE-----EKLGQLDMNEVAAKSLMKEVDVTIPKFRIECTVDLKVPLQKMGINSVFD 301
            |.....:.::|     |||......|....:   ||.|.:|||:::...|:....|.:|:..||.
  Rat   195 PDEGVDIRKVESSLTFEKLTAWTKPEFIYST---EVYVYLPKFQLQEQYDMTALFQHLGMIDVFS 256

  Fly   302 AGQADLSDLFEMKTPQK---ISEARHKVFLNVTEFGCEVAPE---------AEVQPEVLKKNPDR 354
            ..:||||.:    .|:|   :|:..|:..:.|.|.|.|.|..         :|..|.        
  Rat   257 EIKADLSGM----CPEKDLCVSKFVHECVVEVNEEGTEAAAASAADCCYSCSEYTPT-------- 309

  Fly   355 KFFKADRPFVFAIRDRK--NVYFVGHFVKP 382
              |.|||||:|.||..:  ::.|.|.|..|
  Rat   310 --FCADRPFLFFIRHNQTNSILFCGRFSSP 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn47CNP_001163116.1 SERPIN 18..379 CDD:238101 94/350 (27%)
Serpinb9dNP_001100821.1 SERPIN 1..337 CDD:294093 95/353 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.